SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSSSCP00000018541 from Sus scrofa 69_10.2

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  ENSSSCP00000018541
Domain Number - Region: 52-113
Classification Level Classification E-value
Superfamily Immunoglobulin 0.000152
Family I set domains 0.039
Further Details:      
 
Domain Number - Region: 275-314
Classification Level Classification E-value
Superfamily TNF receptor-like 0.0137
Family TNF receptor-like 0.012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSSSCP00000018541   Gene: ENSSSCG00000017493   Transcript: ENSSSCT00000019046
Sequence length 326
Comment pep:known chromosome:Sscrofa10.2:12:22913243:22921116:-1 gene:ENSSSCG00000017493 transcript:ENSSSCT00000019046 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MRAWVLLSAVLWYLTGVGWQRSSERNEKGFIYGKPGHPVKVYVKLHHSSPILVCMDFKLA
EKETVDPTYLWIGPNEKPLTGNDRINITKTGKLMVKDFLEPLSGLYTCTLSYKTVKAETQ
EEKMVKQRYDFMIFAYREPDYSYQMAVRFTTKSCVGKYNDLLFRVLKKILDNLISDLSCH
VIAPSYKCHFVKLPKHGLVHELFIAFQVNPFAPGWKGTCNGSVDCEDITNHNILQARDRI
EEFFRSQAYIFNHDFNKTLPAMHFVDHSFQIVRMDSCRPGFGKNEGLHSNCATCCVVCGP
GTFSPDVDVTCQTCVSIHIYGAKSCP
Download sequence
Identical sequences C8C4M8
XP_005653969.1.46622 ENSSSCP00000018541 ENSSSCP00000018541

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]