SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSSSCP00000018857 from Sus scrofa 69_10.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSSSCP00000018857
Domain Number 1 Region: 493-791
Classification Level Classification E-value
Superfamily Zn-dependent exopeptidases 1.06e-83
Family Pancreatic carboxypeptidases 0.00000000155
Further Details:      
 
Domain Number 2 Region: 56-378
Classification Level Classification E-value
Superfamily Zn-dependent exopeptidases 1.19e-75
Family Pancreatic carboxypeptidases 0.00000111
Further Details:      
 
Domain Number 3 Region: 918-1207
Classification Level Classification E-value
Superfamily Zn-dependent exopeptidases 3.31e-68
Family Pancreatic carboxypeptidases 0.0000125
Further Details:      
 
Domain Number 4 Region: 791-871
Classification Level Classification E-value
Superfamily Carboxypeptidase regulatory domain-like 3.73e-19
Family Carboxypeptidase regulatory domain 0.0000291
Further Details:      
 
Domain Number 5 Region: 379-457
Classification Level Classification E-value
Superfamily Carboxypeptidase regulatory domain-like 5.49e-16
Family Carboxypeptidase regulatory domain 0.00066
Further Details:      
 
Domain Number 6 Region: 1208-1306
Classification Level Classification E-value
Superfamily Carboxypeptidase regulatory domain-like 0.000000000000334
Family Carboxypeptidase regulatory domain 0.0093
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSSSCP00000018857   Gene: ENSSSCG00000017799   Transcript: ENSSSCT00000019371
Sequence length 1374
Comment pep:known_by_projection chromosome:Sscrofa10.2:12:48551876:48622821:1 gene:ENSSSCG00000017799 transcript:ENSSSCT00000019371 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MASGWDARPPWRRGRLPLLMCLLLLLRSPVQAAHIKKAEATTTTTSAGAEADEGQFDRYY
HEEELGSVLREAAAAGPPGLARLFSIGSSVEGRPLWVLRLTAGLGPPPPDGDTGLDAAGP
LLPGRPQVKLVGNMHGDETVSRQVLIYLARELAAGYRRGDPRLVLLLNTTDVYVLPSLNP
DGFERAREGDCGLSDSGPPGASGRDNSRGRDLNRSFPDQFSTGEPPSLDDVPEVRALIEW
IRRNKFVLSGNLHGGSVVASYPFDDSPEHKATGIYSKTSDDEVFKYLAKAYASNHPIMKT
GAPHCPGDEDETFKDGITNGAHWYDVEGGMQDYNYVWANCFEITLELSCCKYPPASQLKQ
EWENNRESLITLIEKVHIGVKGFVKDSVTGAGLENATISVAGISHNITTGRFGDFHRLLV
PGTYNITAVSTGYMPLTINNIIVKEGPAAIVNFSLRPTVASLIPAATEVVVTASTVAILN
SALGTQSSHQPVQPQDFHHHHFPDMEIFLRRFANEYPNITRLYSLGKSVESRELYVMEIS
DNPGVHEPGEPEFKYIGNMHGNEVVGRELLLNLIEYLCKNFGTDPEVTDLVLNTRIHLMP
SMNPDGYEKAQEGDSISVIGRNNSNNFDLNRNFPDQFIQITDPTQPETIAVMSWMKSYPF
VLSANLHGGSLVVNYPFDDDEQGLATYSKSPDDAVFQQIALSYSKENSQMFQGRPCKNMY
PNEYFPHGITNGASWYNVPGGMQDWNYLQTNCFEVTIELGCIKYPFEKDLPKFWEQNRRS
LIQFMKQVHQGVKGFVLDATDGRGILNATISVAEINHPVTTYKTGDYWRLLVPGTYKITA
SARGYNPVTKNVTVKSEGAVQVNFTLVRSSTDSNNESKKGKGDSTNADDASDPTTKEFET
LIKDLSAENGLEGFILRTSSNLALYRYHSYKDLSEFLRGLVMNYPHITNLTNLGQSAEYR
HIWSLEISNKPNVSEPEEPKIRFVAGIHGNAPVGTELLLALAEFLCLNYKKNPAVTQLVD
RTRIVIVPSLNPDGRERAQEKDCTSKIGQTNARGKDLDTDFTNNASQPETKAIIENLIQK
QDFSLSVALDGGSVLVTYPYDKPVQTVENKETLKHLASLYANNHPSMHMGQPSCPNKSDE
NIPGGVMRGAEWHSHLGSMKDYSVTYGHCPEITVYTSCCYFPSAAQLPSLWAENKKSLLS
MLVEVHKGVHGFVKDKTGKPISKAVIVLNEGIKVHTKEGGYFHVLLAPGVHNINAIADGY
QQQHSQVFVHHDAASSVVIVFDTDNRIFGLPRELVVTVSGATMSALILTACIIWCICSIK
SNRHKDGFHRLRQHHDEYEDEIRMMSTGSKKSLLSHEFQDETDTEEETLYSSKH
Download sequence
Identical sequences ENSSSCP00000018857 ENSSSCP00000018857 9823.ENSSSCP00000018857

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]