SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSSSCP00000020854 from Sus scrofa 69_10.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSSSCP00000020854
Domain Number 1 Region: 33-93
Classification Level Classification E-value
Superfamily Immunoglobulin 0.000000367
Family I set domains 0.042
Further Details:      
 
Weak hits

Sequence:  ENSSSCP00000020854
Domain Number - Region: 138-180
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.000667
Family TSP-1 type 1 repeat 0.0053
Further Details:      
 
Domain Number - Region: 221-284
Classification Level Classification E-value
Superfamily Immunoglobulin 0.0232
Family I set domains 0.061
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSSSCP00000020854   Gene: ENSSSCG00000027989   Transcript: ENSSSCT00000030944
Sequence length 366
Comment pep:known_by_projection chromosome:Sscrofa10.2:6:40166080:40177771:-1 gene:ENSSSCG00000027989 transcript:ENSSSCT00000030944 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MLAMLWLLSLSIRASWAQVLISCAYKSLCQQALLSGNDVVLQCDHLKAHWYFSSLLGEEP
LLLSSMPNIRKLPGGSLQLTNPQPSQTGLYHCQDNDKALVVEYEIDFQDVTTLHITHKDL
GQKPLQNETLGLGGKELIFTHWEPWQDCNLCGEPGERKRLGFCYIEESLEKPMPCSLYLR
TEKVHNSRLRPEMQVEACLTRCNHIKELNQPYLTFDISQLGKLTNSMWLTCPLASIYRPI
TWEANSIPLTWKGQLSGQDVNTVLDASNGGSRLQVFQGAIYECFLQQELTARFNPRSKLD
VLASLNTEDLQQQPGVEEAWKGKADSVLKGLKLMLLLGTGLGLLGVLFKLFHPSWGRRRD
QLLVVK
Download sequence
Identical sequences ENSSSCP00000020854 ENSSSCP00000020854

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]