SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSSSCP00000021325 from Sus scrofa 69_10.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSSSCP00000021325
Domain Number 1 Region: 2-78
Classification Level Classification E-value
Superfamily Transglutaminase, two C-terminal domains 3.14e-21
Family Transglutaminase, two C-terminal domains 0.0000162
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSSSCP00000021325   Gene: ENSSSCG00000026043   Transcript: ENSSSCT00000027125
Sequence length 79
Comment pep:known chromosome:Sscrofa10.2:17:37610108:37611677:-1 gene:ENSSSCG00000026043 transcript:ENSSSCT00000027125 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MLFANPLDEPVKDCVLKVEGSGLLLGSLRIDVPALRPKERSRVRFEIMPTRSGTKQLLAD
FSCNKFPAIKSMLSIDVAE
Download sequence
Identical sequences ENSSSCP00000021325 ENSSSCP00000021325

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]