SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSSSCP00000021508 from Sus scrofa 69_10.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSSSCP00000021508
Domain Number 1 Region: 30-73
Classification Level Classification E-value
Superfamily TNF receptor-like 0.000000037
Family TNF receptor-like 0.0043
Further Details:      
 
Domain Number 2 Region: 76-105
Classification Level Classification E-value
Superfamily TNF receptor-like 0.00000171
Family TNF receptor-like 0.0043
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSSSCP00000021508   Gene: ENSSSCG00000026674   Transcript: ENSSSCT00000026603
Sequence length 107
Comment pep:known chromosome:Sscrofa10.2:2:616546:619456:1 gene:ENSSSCG00000026674 transcript:ENSSSCT00000026603 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MPVSPSCLKVTLTTSETPRDYSEHEAPSARLSGKGCPAGQYVSQPMAGDPGVVACRPCQP
GTFSPYASEETSCLPCALCRKDQEVVTECSPTRDRQCQCKRGHFFCD
Download sequence
Identical sequences ENSSSCP00000021508 ENSSSCP00000021508

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]