SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSSSCP00000022080 from Sus scrofa 69_10.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSSSCP00000022080
Domain Number 1 Region: 13-103
Classification Level Classification E-value
Superfamily DEATH domain 5.59e-22
Family DEATH domain, DD 0.0044
Further Details:      
 
Domain Number 2 Region: 137-217
Classification Level Classification E-value
Superfamily Toll/Interleukin receptor TIR domain 0.0000000000000222
Family Toll/Interleukin receptor TIR domain 0.0093
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSSSCP00000022080   Gene: ENSSSCG00000022737   Transcript: ENSSSCT00000032536
Sequence length 219
Comment pep:known scaffold:Sscrofa10.2:GL896304.2:7389:8943:-1 gene:ENSSSCG00000022737 transcript:ENSSSCT00000032536 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAEGGSGAESAPPTPSMSXNVRVRHRLSLFLNVRTQVAADWTGLAEEMNFEYLEIRRLET
HPDPTRSLLDDWQGRPGASVGRLLELLAKLGRDDVLVELGPSIGTLASLRTGDTSKGCPM
GVCNKVTTVPAACSLSRRCRRMVVVVSDDYLQSKECDFQTKFALSLSPGAHQKRLIPVKY
KSMKKEFPSILRFITVCDYTNPCTKSWFWTRLARALSLP
Download sequence
Identical sequences ENSSSCP00000022080 ENSSSCP00000022080

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]