SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSSSCP00000022250 from Sus scrofa 69_10.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSSSCP00000022250
Domain Number 1 Region: 407-457
Classification Level Classification E-value
Superfamily BPTI-like 0.0000000000156
Family Small Kunitz-type inhibitors & BPTI-like toxins 0.0088
Further Details:      
 
Domain Number 2 Region: 72-133
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.0000000000275
Family TSP-1 type 1 repeat 0.0022
Further Details:      
 
Domain Number 3 Region: 729-786
Classification Level Classification E-value
Superfamily Immunoglobulin 0.00000000175
Family V set domains (antibody variable domain-like) 0.053
Further Details:      
 
Domain Number 4 Region: 4-47
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.0000811
Family TSP-1 type 1 repeat 0.012
Further Details:      
 
Weak hits

Sequence:  ENSSSCP00000022250
Domain Number - Region: 133-165
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.00249
Family TSP-1 type 1 repeat 0.0055
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSSSCP00000022250   Gene: ENSSSCG00000028039   Transcript: ENSSSCT00000028830
Sequence length 848
Comment pep:known scaffold:Sscrofa10.2:GL894139.2:12187:30263:-1 gene:ENSSSCG00000028039 transcript:ENSSSCT00000028830 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
AARCGRASAGHQTRLVFCTIDNEAYPDHMCQHQPRPADRRPCSPQPCPHTKRTSYLHRPR
VWHLAGAQRVCGNSWRLGPWTPCSASCGGGSQSRSVFCISSDGAGVQEATEDAECAGLPG
KPPTTQACNMQRCAVWRTEPWGECSVSCGAXEGSLIHATECSLGDRPPLTEPCVRDXRAV
PGIFPLPPCLVGAPPHXKPADVEPCNTQPCHLPPEVPSIQDAHTSPRDPWMSLGPREAPA
SEGGVSSLGGMEREPSARGNPRGDQSPHLLARGPAPSLQHPSYRQPLWSGSGPQDCRHSP
HGCCPDGHTTSLGPQWQGCPGASCHQSRWVPLPPHRSEREDPSQAPTPSGTWDTGLPLGP
SLGEPQSLHPGMLEAQGPRFGCCPDGVSGYRAAVTGLGWGCGXPSYAYPVRCLLPSAHGS
CTDWAARWYFIASGCHGNANNFASEEACMNSCRGPQHGPRRSGPGASGQSIHRDGGGSGP
GGQQEAXRHVTGPKVQRKPLPSGGPWWRDRESGLGAVDHRQAFGEWHQGQELGPSAPGLG
SDTRRHVPPSHSNSYRWDWGPGPRPGTEPVGAKTLRSQPGGPCSGHSADGEAQLQRHEAG
PGLGSPWRVVPGSRIRSCWHSPEPAYXGSGRGLPSSPQVPPPPRQPGLGQPSSSGNVLKR
PLLMSGAPMGKRGKPFTSPLRYFALTLFYRFGTQAPFFLKVRGHEGPGFPPLPGLGRAST
ASQRPLPSRNGLPVWADGHRVHQSPDGTLLIHNLQARDAGSYTCSAYRGNQAVSRSTEVK
VVPPGVPLARAPSCRASSKQTACLHTSQTPNCDLILQAQLCGNEYYSSFCCASCSRFQPP
AQPIWQRG
Download sequence
Identical sequences ENSSSCP00000022250 ENSSSCP00000022250

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]