SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSSSCP00000023358 from Sus scrofa 69_10.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSSSCP00000023358
Domain Number 1 Region: 38-85
Classification Level Classification E-value
Superfamily TNF receptor-like 0.000000000000549
Family TNF receptor-like 0.0059
Further Details:      
 
Domain Number 2 Region: 105-162
Classification Level Classification E-value
Superfamily TNF receptor-like 0.000000000000875
Family TNF receptor-like 0.0023
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSSSCP00000023358   Gene: ENSSSCG00000022619   Transcript: ENSSSCT00000024145
Sequence length 200
Comment pep:known scaffold:Sscrofa10.2:JH118875.1:4504:9974:-1 gene:ENSSSCG00000022619 transcript:ENSSSCT00000024145 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MKLYLLNVLLLLPSWSLRLSYSEETFPPKYLHYDPETSKQLMCDKCPPGTSLKQHCTARR
KTVCAPCPDHYYTDSWHTSDECLYCTPVCKELQYVKQECNRTHNRVCECEEGRYLELEFC
LKHRSCPPGFGVLHAGTPERNTVCKRCPDGFFSNETSSKAPCRKHTNCSALGLLLTQKGN
ATHDNTCSGSSESTHKCGIG
Download sequence
Identical sequences ENSSSCP00000023358 ENSSSCP00000023358

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]