SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSSSCP00000023588 from Sus scrofa 69_10.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSSSCP00000023588
Domain Number 1 Region: 1-90
Classification Level Classification E-value
Superfamily C2 domain (Calcium/lipid-binding domain, CaLB) 4.32e-22
Family PLC-like (P variant) 0.00000814
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSSSCP00000023588   Gene: ENSSSCG00000030702   Transcript: ENSSSCT00000031532
Sequence length 107
Comment pep:known chromosome:Sscrofa10.2:17:42387887:42388533:-1 gene:ENSSSCG00000030702 transcript:ENSSSCT00000031532 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
VISAKLKENKKNWFGPSPYVEVTVDGQSKKTEKCNNTNSPKWKQPLTVIVTPVSKLHFRV
WSHQTLKSDVLLGTAALDIYETLKSNNMKRMYVKIIEVMLSFCFSSR
Download sequence
Identical sequences ENSSSCP00000023588 ENSSSCP00000023588

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]