SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSSSCP00000024096 from Sus scrofa 69_10.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSSSCP00000024096
Domain Number 1 Region: 47-178
Classification Level Classification E-value
Superfamily L domain-like 4.76e-25
Family Rab geranylgeranyltransferase alpha-subunit, C-terminal domain 0.061
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSSSCP00000024096   Gene: ENSSSCG00000027239   Transcript: ENSSSCT00000025538
Sequence length 288
Comment pep:known scaffold:Sscrofa10.2:GL892750.2:71310:112201:-1 gene:ENSSSCG00000027239 transcript:ENSSSCT00000025538 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MTWDPNHLPCAVQRTTNLGKVAEAPLIICYQAVEDQLKICGHKRDADVFELFLSQKELTE
VIDLSRFKKLKYLWLHHNKLHGITFLTRNYCLAELYLNNNAIFDIEGLHYLPSLHILLLH
HNELTNIDATVKELKGMLNLKTLSLYQNPLCQYNLYRLYIIYHLPGVELLDRNQVTEKER
RSMITIFNHKKAHIVQSIAFGGKVDASWDPRSPFKQKPAQRVPSDFAFANNVDKTVFDDP
EDAVFVRSMKRSAMAITCLNWDTVPTREEKYLEENDRGPTQMLTVTLR
Download sequence
Identical sequences ENSSSCP00000024096 ENSSSCP00000024096

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]