SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSSSCP00000024109 from Sus scrofa 69_10.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSSSCP00000024109
Domain Number 1 Region: 13-262
Classification Level Classification E-value
Superfamily Trypsin-like serine proteases 2.26e-83
Family Eukaryotic proteases 0.000000102
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSSSCP00000024109   Gene: ENSSSCG00000023127   Transcript: ENSSSCT00000028653
Sequence length 263
Comment pep:known chromosome:Sscrofa10.2:6:12263236:12268566:1 gene:ENSSSCG00000023127 transcript:ENSSSCT00000028653 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAFLWILSCFALVGTAFSCGVPAIPPVLSGLSRIVNGENAVPGSWPWQVSLQDGTGFHFC
GGSLISEDWVVTAAHCGVTTSDVVVAGEYDQASDAEDIQVLKIAKVFKNPNFSLLTVRND
ITLLKLATPARFSRTVSAVCLPSASDDFPAGTLCATTGWGKTKYTALKTPDKLQQAALPI
VSSTVCKSYWGSKVTDVMICAGASGVSSCMGDSGGPLVCQKNGAWTLVGIVSWGSSTCST
TTPAVYARVTALIPWVQQILANN
Download sequence
Identical sequences I3LJ52
ENSSSCP00000024109 ENSSSCP00000024109 XP_003355797.1.46622

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]