SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSSSCP00000025087 from Sus scrofa 69_10.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSSSCP00000025087
Domain Number 1 Region: 554-644
Classification Level Classification E-value
Superfamily Carboxypeptidase regulatory domain-like 0.0000000432
Family Carboxypeptidase regulatory domain 0.025
Further Details:      
 
Domain Number 2 Region: 473-545
Classification Level Classification E-value
Superfamily Starch-binding domain-like 0.00000392
Family Rhamnogalacturonase B, RhgB, middle domain 0.039
Further Details:      
 
Weak hits

Sequence:  ENSSSCP00000025087
Domain Number - Region: 20-62
Classification Level Classification E-value
Superfamily Cna protein B-type domain 0.00118
Family Cna protein B-type domain 0.007
Further Details:      
 
Domain Number - Region: 403-458
Classification Level Classification E-value
Superfamily Cna protein B-type domain 0.0392
Family Cna protein B-type domain 0.011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSSSCP00000025087   Gene: ENSSSCG00000025565   Transcript: ENSSSCT00000030288
Sequence length 793
Comment pep:known scaffold:Sscrofa10.2:JH118682.1:266:33564:1 gene:ENSSSCG00000025565 transcript:ENSSSCT00000030288 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
FSVCGQISILRFPDTVKQMSKYKVVLSSQDKDKSLVTVETDAQGSFCFKAKPGTYKVQVW
YPLIETRAGLTLKPQTLLLAVTDRPVMDVAFVQFLXSVSGKVSCLDTCGDLLVTLQSLSR
QGEKRSLQLSGKLNSMTFTFDNVLPGKYKTSIMHEDWCWKNKSLEVEVLEEDVSAVEFRQ
TGYMLRCSLSHAITLEFYQDGNGPENVGIYNLSKGVNRFCLSKPGVYKVTPRSCHRFEQA
FYTYDTSSPSILTLTAIRHHVLGTITTDKMMDVTVTIKSSIDSEPALVLGPLKSVQELRR
EQQLAEIESRRQEREKNGGEEGGEGGTKPPVQEMVDELQGPFSYDFSYWARSGEKITVTP
SSKELLFYPPSMEATVSGESCPGKLIEIQGKAGLFLEGQIHPELEGVEIVISEKGASSPL
ITVFTDDKGAYRLHSDLEYTVSSQKEGYVLTAVEGTIGDFKAYALAGVSFEIKAEDDQPL
PGVLLSLSGGVFRSNLLTQDNGILTFSNLSPGQYYFKPMMKEFRFEPSSQMIEVQEGQNL
KITITFFSHPSSCYGTVSSLNGEPEQGVAVEAVGQNDCSIYGEDTVTDEEGKFRLRGLLP
GCVYHVQLKAEGNDHIERALPHHRVITVGNNDIDDVNIIVFRQINQFDLSGNVITSSEYL
PTLWVKLYKSDNLDNPIQTVSLGQSLFFHFPPLLRDGQNYVVLLDSTLPKSQYDYAAGYH
KHITLIFNPATPCRVXEQDIAQGSYIALPLTLLVLLAGYNHDKLIPLLLQLTSRLQGVRA
LGQTASDGSGPED
Download sequence
Identical sequences ENSSSCP00000025087 ENSSSCP00000025087

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]