SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSSSCP00000025658 from Sus scrofa 69_10.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSSSCP00000025658
Domain Number 1 Region: 13-169
Classification Level Classification E-value
Superfamily (Phosphotyrosine protein) phosphatases II 1.9e-40
Family Dual specificity phosphatase-like 0.0005
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSSSCP00000025658   Gene: ENSSSCG00000029874   Transcript: ENSSSCT00000029194
Sequence length 197
Comment pep:known_by_projection chromosome:Sscrofa10.2:12:40562530:40616164:1 gene:ENSSSCG00000029874 transcript:ENSSSCT00000029194 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSSRGHSTLPRTLMAPRMISEGDIGGIAQITSSLFLGRGSVASNRHLLQARGITCIVNAT
IEIPNFNWPQFEYVKVPLADMPHAPIGLYFDTVADKIHSVSRKHGATLVHCAAGVSRSAT
LCIYLMKFHSVCLLEAYNWVKARRPVIRPNVGFWRQLIDYERQLYGKSTVKMVQTPYGIV
PDVYEKESRHLMPYWGI
Download sequence
Identical sequences ENSSSCP00000025658 ENSSSCP00000025658

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]