SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSSSCP00000026833 from Sus scrofa 69_10.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSSSCP00000026833
Domain Number 1 Region: 2-154
Classification Level Classification E-value
Superfamily (Phosphotyrosine protein) phosphatases II 1.66e-60
Family Myotubularin-like phosphatases 0.0000248
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSSSCP00000026833   Gene: ENSSSCG00000024845   Transcript: ENSSSCT00000028956
Sequence length 154
Comment pep:known chromosome:Sscrofa10.2:6:82766571:82768678:-1 gene:ENSSSCG00000024845 transcript:ENSSSCT00000028956 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MDRWLSRLEGCRWLSHVKETLSTACLAAHSMEREGACILVHGAEGTDSTLLVTSLAQIIL
DPLSRTMAGFQELIEREWIQAGHPFQLRCAHSAFSHARPKHEAPTFLLFLDCVWQLGRQF
PLSLEFGEGMLLALFDHAYASPFGTFLCNSEKER
Download sequence
Identical sequences ENSSSCP00000026833 ENSSSCP00000026833

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]