SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSSSCP00000026949 from Sus scrofa 69_10.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSSSCP00000026949
Domain Number 1 Region: 1-92
Classification Level Classification E-value
Superfamily Carboxypeptidase regulatory domain-like 2.94e-23
Family Carboxypeptidase regulatory domain 0.00000554
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSSSCP00000026949   Gene: ENSSSCG00000027797   Transcript: ENSSSCT00000031897
Sequence length 130
Comment pep:known chromosome:Sscrofa10.2:5:35954423:35958343:-1 gene:ENSSSCG00000027797 transcript:ENSSSCT00000031897 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
GVKGQVFDQNETPLPNVIVEVQDRKHICPYRTNKFGEYYLLLLPGSYVIEVTVPGHNPHL
TKVTIPPKSQNFSALKKDILLPFRGQLDHIPESNPLCPMIPLYRDLQGHSVATKPSLFLF
LVTLFHILFK
Download sequence
Identical sequences ENSSSCP00000026949 9823.ENSSSCP00000000519 ENSSSCP00000026949

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]