SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSSSCP00000029549 from Sus scrofa 69_10.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSSSCP00000029549
Domain Number 1 Region: 1193-1530
Classification Level Classification E-value
Superfamily NHL repeat 7.59e-24
Family NHL repeat 0.0017
Further Details:      
 
Domain Number 2 Region: 1374-1392,1425-1534,1572-1740
Classification Level Classification E-value
Superfamily DPP6 N-terminal domain-like 0.000000000549
Family DPP6 N-terminal domain-like 0.025
Further Details:      
 
Domain Number 3 Region: 631-658
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000419
Family Integrin beta EGF-like domains 0.073
Further Details:      
 
Weak hits

Sequence:  ENSSSCP00000029549
Domain Number - Region: 889-959
Classification Level Classification E-value
Superfamily Carboxypeptidase regulatory domain-like 0.000169
Family Carboxypeptidase regulatory domain 0.039
Further Details:      
 
Domain Number - Region: 697-722
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000457
Family Integrin beta EGF-like domains 0.071
Further Details:      
 
Domain Number - Region: 600-624
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000457
Family EGF-type module 0.074
Further Details:      
 
Domain Number - Region: 729-754
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00134
Family EGF-type module 0.061
Further Details:      
 
Domain Number - Region: 565-592
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00152
Family Integrin beta EGF-like domains 0.073
Further Details:      
 
Domain Number - Region: 762-798
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00187
Family EGF-type module 0.056
Further Details:      
 
Domain Number - Region: 535-559
Classification Level Classification E-value
Superfamily EGF/Laminin 0.035
Family EGF-type module 0.043
Further Details:      
 
Domain Number - Region: 2098-2196,2288-2348
Classification Level Classification E-value
Superfamily NHL repeat 0.0628
Family NHL repeat 0.014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSSSCP00000029549   Gene: ENSSSCG00000012644   Transcript: ENSSSCT00000035219
Sequence length 2732
Comment pep:known chromosome:Sscrofa10.2:X:116883587:116900554:-1 gene:ENSSSCG00000012644 transcript:ENSSSCT00000035219 gene_biotype:protein_coding transcript_biotype:nonsense_mediated_decay
Sequence
MEQTDCKPYQPLSKVKHEMDLAYTSSSDESEDGRKPRQSYNSRETLHEYNQELRMNYNSQ
SRKRKEVEKSTQEMEFCETPHTLCSGYQTDMHSVSRHGYQLEMGSDVDTETEGAASPDHA
LRMWIRGMKSEHSSCLSSRANSALSLTDTDHERKSDGENGFKFSPVCCDMEAQAGSTQDM
QSSPHNQFTFRPLPPPPPPPHACTCARKPPPAADSLQRRSMTTRSQPSPAAPAPPTSTQE
SVHLHNSWVLNSNIPLETRHFLFKHGSGSSAIFSAASQNYPLTSNTVYSPPPRPLPRSTF
SRPAFTFNKPYRCCNWKCTALSATAITVTLALLLAYVIAVHLFGLTWQLQPAEGQLYENG
VSKGNRGTESMDTTYSPIGGKVSDKSEKKVFQKGRAIDTGEVDIGAQVMQTIPPGLFWRF
QITIHHPIYLKFNISLAKDSLLGIYGRRNIPPTHTQFDFVKLMDGKQLVKQDSKSSDDTQ
HSPRNLILTSLQETGFIEYMDQGPWYLAFYNDGKKMEQVFVLTTAIEIMDDCSTNCNGNG
ECISGHCHCFPGFLGPDCARDSCPVLCGGNGEYEKGHCVCRNGWKGPECDVPEEQCIDPT
CFGHGTCIMGVCICVPGYKGEICEEEDCLDPMCSNHGICVKGECHCSTGWGGVNCETPLP
ICQEQCSGHGTFILDTGMCSCDPKWTGSDCSTELCTMECGSHGVCSRGICQCEEGWVGPT
CEERSCHSHCAEHGQCKDGKCECSPGWEGDHCTIAHYLDAVRDGCPGLCFGNGRCTLDQN
GWHCVCQVGWSGTGCNVVMEMLCGDNLDNDGDGLTDCVDPDCCQQSNCYISPLCQGSPDP
LDLIQQSQPLFSQHTSRLFYDRIKFLIGKDSTHVIPPEISFDSRRACVIRGQVVAVDGTP
LVGVNVSFLHHSDYGFTISRQDGSFDLVAIGGISVVLIFDRSPFLSEKRTLWLPWNQFIV
VEKVTMQRVVSDPPSCDISNFISPNPIVLPSPLTSFGGSCPERGTIVPELQVVQEEIPIP
SSFVRLSYLSSRTPGYKTLLRILLTHSTIPVGMIKVHLTVAVEGRLMQKWFPAAINLVYT
FAWNKTDIYGQKVWGLAEALVSVGYEYEMCPDFILWEKRTVILQGFEMDASNLGGWSLNK
HHILNPQSGIIHKGNGENMFISQQPPVISTIMGNGHQRSVACTNCNGPAHNNKLFAPVAL
ASGPDGSVYVGDFNFVRRIFPSGNSVSILELRNRDTRHSTSPAHKYYLAMDPVSESLYLS
DTNTRKVYKLKSLVETKDLSKNFEVVAGTGDQCLPFDQSHCGDGGRASEASLNSPRGITV
DRHGFIYFVDGTMIRRIDENAVITTVIGSNGLTSTQPLSCDSGMDITQVRLEWPTDLAVN
PMDNSLYVLDNNIVLQISENRRVRIIAGRPIHCQVPGIDHFLVSKVAIHSTLESARAISV
SHSGLLFIAETDERKVNRIQQVTTNGEISIMAGAPTDCDCKIDPNCDCFSGDGGYAKDAK
MKAPSSLAVSPDGTLYVADLGNVRIRTISRNQAHLNDMNLYEIASPADQELYQFTVNGTH
LHTLNLITRDYVYNFTYNAEGDLGAITSSNGNSVHIRRDASGIPLWLVVPGGQVYWLTIS
SNGVLKRVSAQGYNLALMTYPGNTGLLATKSNENGWTTVYEYDPEGHLTNATFPTGEVSS
FHSDLEKLTKVELDTSNRENVLMSTNLTATTTIYILKQENTQSTYRVSPDGSLRVTFTSG
MEISLSSEPHILAGAVNPTLGKCNISLPGEHNANLIEWRQRKEQNKGNVSAFERRLRAHN
RNLLSIDFDHMTRTGKIYDDHRKFTLRILYDQTGRPVLWSPVSRYNEVNITYSPSGLVTF
IQRGTWNEKMEYDQSGKIISRTWADGKIWSYTYLEKSVILLLHSQRRYIFEYDQSDCLLS
VTMPSMVRHSLQTMLSVGYYRNIYTPPDSSTSFIQDYSRDGRLLQTLHLGTGRRVLYKYT
KQARLSEILYDTTQVTLTYEESSGVIKTIHLMHDGFICTIRYRQTGPLIGRQIFRFSEEG
LVNARFDYSYNNFRVTSMQAVINETPLPIDLYRYVDVSGRTEQFGKFSVINYDLNQVITT
TVMKHTKIFSANGQVIEVQYEILKAIAYWMTIQYDNMGRMVICDIRVGVDANITRYFYEY
DADGQLQTVSVNDKTQWRYSYDLNGNINLLSHGNSARLTPLRYDLRDRITRLGEIQYKMD
EDGFLRQRGNDIFEYNSNGLLQKAYNKASGWTVQYYYDGLGRRVASKSSLGQHLQFFYAD
LANPIRVTHLYNHTSSEITSLYYDLQGHLIAMELSSGEEYYVACDNTGTPLAVFSSRGQV
IKEILYTPYGDIYHDTYPDFQVIIGFHGGLYDFLTKLVHLGQRDYDVVAGRWTTPNHHIW
KELNLLPKPFNLYSFENNYPVGKIQDVAKYTTDIGSWLELFGFQLHNVLPGFPKPELGNL
ELTYELLQLQTKTQEWDPGKTILGIQCELQKQLRNFISLDQLPMTPRYSDGRCLEGGKQP
RFAAVPSVFGKGIKFAIKDGIVTADIIGVANEDSRRLAAILNNAHYLENLHFTIEGRDTH
YFIKLGSLEEDLVLIGNTGGRRILENGVNVTVSQMTSVLNGRTRRFADIQLQHGALCFNI
RYGTTVEEEKNHVLEMARQRAVAQAWTKEQRRLQEGEEGIRAWTEGEKQQLLSTGRVQGY
DGYFVLSVEQYLELSDSANNIHFMRQSEIGRR
Download sequence
Identical sequences XP_003135406.2.46622 XP_020936329.1.46622 XP_020936330.1.46622 XP_020936331.1.46622 XP_020936332.1.46622 ENSSSCP00000030256 ENSSSCP00000029549

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]