SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSSSCP00000000020 from Sus scrofa 69_10.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSSSCP00000000020
Domain Number 1 Region: 338-466
Classification Level Classification E-value
Superfamily PH domain-like 1.33e-25
Family Ran-binding domain 0.0042
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSSSCP00000000020   Gene: ENSSSCG00000000019   Transcript: ENSSSCT00000000020
Sequence length 469
Comment pep:known chromosome:Sscrofa10.2:5:1512925:1526924:-1 gene:ENSSSCG00000000019 transcript:ENSSSCT00000000020 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAKRIAEKELTDRNWDQEDEAEEVGTFSVASEEVLKNRAIKKAKRRNVGFESDSGGAFKG
FKGLVVPSGGGGFSGFGNSAGGKPLEGLSNGSSVTAAPPFSSSRAATEAKTTFGSVAVNG
PASSVDKKMSSPKTNGDSQQPSASGLASSTACPGNAYHKQLAALNCSVRDWIVKHVNTNP
LCDLTPIFKDYEKYLASIEQQHGNSGSSHSESEKNKIAVETQSPSLFGSKLQQESTFLFH
GSTTEAASEKKMEALSEKNKEPSLGAASASFNFGKKIDSSVLGSLNSGPLTGFSFSSGNS
SLFGKDTTPSKPVSSPFSAKTLETRAEGGGNECREGGDEEENDEPPKVVVTEVKEEDAFY
SKKCKLFYKKDNEFKEKGVGTLHLKHTANQKTQLLVRAETNLGNILLNVLIPPNMPCSRT
GKNNVLVLLIPNPPIDATNASVPVTMLIRVKTSEDADELHKILLEKKDS
Download sequence
Identical sequences ENSSSCP00000000020 ENSSSCP00000000020

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]