SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSSSCP00000001169 from Sus scrofa 69_10.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSSSCP00000001169
Domain Number 1 Region: 112-316
Classification Level Classification E-value
Superfamily Metallo-hydrolase/oxidoreductase 1.3e-18
Family beta-CASP RNA-metabolising hydrolases 0.072
Further Details:      
 
Domain Number 2 Region: 19-122
Classification Level Classification E-value
Superfamily ISP domain 0.000000000000416
Family Ring hydroxylating alpha subunit ISP domain 0.052
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSSSCP00000001169   Gene: ENSSSCG00000001099   Transcript: ENSSSCT00000001195
Sequence length 577
Comment pep:known_by_projection chromosome:Sscrofa10.2:7:21032289:21109183:-1 gene:ENSSSCG00000001099 transcript:ENSSSCT00000001195 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSSIEQTTEILLCLSPAEAANLKEGINFVRNKSTGKDYILFKNKSRLKACKNMCKHQGGL
FIKDIEDLNGRSVKCTKHNWKLDVSSMKYINPPGSFCQDELVVEKDEENGVLLLELNPPN
PWDSEPRSPEDLAFGEVQITYLTHACMDLKLGDKRMVFDPWLIGPAFARGWWLLHEPPSD
WLERLSRADLIYISHMHSDHLSYPTLKKLAERRPDVPIYVGNTERPVFWNLNQSGVQLTN
INVVPFGIWQQVDKNLRFMILMDGVHPEMDTCIIVEYKGHKILNTVDCTRPNGGRLPMKV
ALMMSDFAGGASGFPMTFSGGKFTEEWKAQFIKTERKKLLNYKARLVKDLQPRIYCPFAG
YFVESHPADKYIKETNIKNDPNELNNLIKKNSEVVTWTPRPGATLDLGRMLKDPTDSKGI
VEPPEGTKIYKDSWDFGPYLNILNAAIGDEIFRHSSWIKEYFTWAGFKDYNLVVRMIETD
EDFSPLPGGYDYLVDFLDLSFPKERPSREHPYEEIRSRVDVIRHVVKNGLLWDDLYIGFQ
TRLQRDPDIYHHLFWNHFQIKLPLTPPDWKSFLMCSG
Download sequence
Identical sequences F1RUD5
ENSSSCP00000001169 ENSSSCP00000001169

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]