SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSSSCP00000001278 from Sus scrofa 69_10.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSSSCP00000001278
Domain Number 1 Region: 47-138
Classification Level Classification E-value
Superfamily Retrovirus capsid dimerization domain-like 2.29e-40
Family SCAN domain 0.0000371
Further Details:      
 
Domain Number 2 Region: 511-568
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 5.65e-26
Family Classic zinc finger, C2H2 0.0045
Further Details:      
 
Domain Number 3 Region: 459-512
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 7.41e-25
Family Classic zinc finger, C2H2 0.0039
Further Details:      
 
Domain Number 4 Region: 288-345
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 4.94e-24
Family Classic zinc finger, C2H2 0.0043
Further Details:      
 
Domain Number 5 Region: 372-429
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.03e-21
Family Classic zinc finger, C2H2 0.0048
Further Details:      
 
Domain Number 6 Region: 335-367
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.000000000245
Family Classic zinc finger, C2H2 0.0057
Further Details:      
 
Domain Number 7 Region: 253-302
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000000363
Family Classic zinc finger, C2H2 0.0086
Further Details:      
 
Domain Number 8 Region: 419-451
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000000205
Family Classic zinc finger, C2H2 0.0095
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSSSCP00000001278   Gene: ENSSSCG00000001209   Transcript: ENSSSCT00000001307
Sequence length 610
Comment pep:known_by_projection chromosome:Sscrofa10.2:7:24132089:24154095:-1 gene:ENSSSCG00000001209 transcript:ENSSSCT00000001307 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MASIWAIQAHKDQDELLEVKVEEEEDVKEEHKYTTRQDQNLQKNNTHSREVFRQHFRHFC
YQETSGPREALSRLRELCHQWLRPETHTKEQILELLVLEQFLTILPEELQAWVQEQHPES
GEEVVTVLEALERELDEPGYQVSVHTEEQEMFLQEVAPLGSEQEPGMSLPSVKVQLKCES
PDLEAQQEQVSDVDTGNEYRNLTPKQEVSEEMKSYGNISSKFENEIAQSTGYEKTCEPQE
KTEEPSGYSREDTCHENGVSLTENSDRPEQQRVCPGEKLYECDDCGKAFSQHSRLLEHQR
IHTGDRPYKCEECGKTFRGRTVLIRHKVIHTGEKPYKCNECGKAFGRWSALNQHQRLHTG
EKHYHCNECGKAFSQKAGLFHHLKIHTRDKPYHCTQCNKSFSRRSILTQHQGVHTGAKPY
ECNECGKAFVYNSSLVSHQEIHHKEKCYQCKECGKSFSQSGLIQHQRIHTGEKPYKCDVC
GKAFIQRTSLIEHQRIHTGERPYKCDTCGKAFTQRSVLTEHQRIHTGERPYKCDECGNAF
RGITSLIQHQRIHTGEKPYQCDECGKAFRQRKKTSYKEILLKNRCEPQAGVNLLLSSLIP
EWQSSCRKDL
Download sequence
Identical sequences ENSSSCP00000001278 9823.ENSSSCP00000001278 ENSSSCP00000001278

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]