SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSSSCP00000001285 from Sus scrofa 69_10.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSSSCP00000001285
Domain Number 1 Region: 47-139
Classification Level Classification E-value
Superfamily Retrovirus capsid dimerization domain-like 5.49e-40
Family SCAN domain 0.0000313
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSSSCP00000001285   Gene: ENSSSCG00000001216   Transcript: ENSSSCT00000001314
Sequence length 142
Comment pep:known chromosome:Sscrofa10.2:7:24276047:24276472:-1 gene:ENSSSCG00000001216 transcript:ENSSSCT00000001314 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
LRMAAAPRALSALAGQASEEQGEIIKVKVKEEDHIWDQESCIQKNLSHTRELSRQRFRQL
CYQETPGPREALSQLRELCRQWLSPEIHTKEQILELLVLEQLLTILPEELQAWVREHHPE
SGEEVVTVLEDLERELDEPRQQ
Download sequence
Identical sequences ENSSSCP00000001285 ENSSSCP00000001285 9823.ENSSSCP00000001285

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]