SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSSSCP00000002625 from Sus scrofa 69_10.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSSSCP00000002625
Domain Number 1 Region: 881-1174
Classification Level Classification E-value
Superfamily (Phosphotyrosine protein) phosphatases II 2.83e-91
Family Higher-molecular-weight phosphotyrosine protein phosphatases 0.000013
Further Details:      
 
Domain Number 2 Region: 215-359
Classification Level Classification E-value
Superfamily PH domain-like 1.44e-34
Family Third domain of FERM 0.0016
Further Details:      
 
Domain Number 3 Region: 107-213
Classification Level Classification E-value
Superfamily Second domain of FERM 1.28e-29
Family Second domain of FERM 0.00034
Further Details:      
 
Domain Number 4 Region: 21-106
Classification Level Classification E-value
Superfamily Ubiquitin-like 8.06e-18
Family First domain of FERM 0.0079
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSSSCP00000002625   Gene: ENSSSCG00000002425   Transcript: ENSSSCT00000002694
Sequence length 1178
Comment pep:known_by_projection chromosome:Sscrofa10.2:7:116875525:116952822:-1 gene:ENSSSCG00000002425 transcript:ENSSSCT00000002694 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MPLPFGLKLKRTRRYTVSSKSCLVARIQLLNNEFVEFTLSVESTGQESLEAVAQRLELRE
ITYFSLWYYNKQNQRRWVDLEKPLKKQLDKYALEPTVYFGVVFYVPSVSQLQQEITRYQY
YLQLKKDILEGNIPCTLEQAIQLAGLAVQADFGDFDQYESQDFLQKFALLPVEWLQDEKV
LEEATQKVALLHQKYRGLTAPDAEMLYMQEVERMDGYGEESYPAKDSQGSDISIGACLEG
IFVKHKNGRPPVVFRWHDIANMSHNKSFFALELANKEETIQFQTEDLETAKYVWRLCVAR
HKFYRLNQCSLQTQPVIVNPIRRRSSSRMSLPKPQPYVMAPPPQLHYNGHYTEPYTSSQD
NLFVTNQNGYYCHSQTSLDRAQIDLSGRIRNGSVYSAQSTNSLNNPQPYLQPSPMSSNPS
ITGSDVMRPDYVPSHRHSALIPPSYRPTPDYETVMKQLRRGLAPAERQSHSLRNLNIGNS
YAYSRPDALVYSQPEIREHAHFTSPQSAHYPFSLNYSFHSQAPYPYPVERRPVVGAVSVP
ELTNVQLQAQEYPAPNIMRTQVYRPPPPYPYPRPANSTPDLSRHLYISSSNPDLITRRVH
HSVQTFQEDSLPVAHSLQEVSEPLTSARHAQLQKRNSIEIAGLTHGLDGLRLKERTMSAS
AADVAPRAVSAGSQPNVVIERTKREEPDEQESLRYGHKKSLSDATMLIHSSEEEEEEEEE
EDPEEEPSAGAHPSPPVPEPRAAYSQEAPPSCPRAPGPLHILEPQSHVPEAERRGRDGSP
VHVQADAQRPRRDGLLTPSMSESDLTTSGRYRARRDSLKKRPVSDLLSGKKNIVEGLPPL
GGMKKNRVDAKKIGPLKLAALNGLSLSRLPLPDEGREVPARATNDERCKILEQRLEQGMV
FTEYERILKKRLVDGECSTARLPENAERNRFQDVLPYDDARVELVPTKENNTGYINASHI
KVSVSGIEWDYIATQGPLQNTCQDFWQMVWEQGIAIIAMVTAEEEGGREKSFRYWPRLGS
RHNTVTYGRFKITTRFRTDSGCYATTGLKMKHLLTGQERTVWHLQYTDWPEHGCPEDLKG
FLSYLEEIQSVRRHTNSTSEPKSPNPPLLVHCSAGVGRTGVVILSEIMIACLEHNEVLDI
PRVLDMLRQQRMMMVQTLCQYTFVYRVLIQFLKSSRLI
Download sequence
Identical sequences ENSSSCP00000002625 9823.ENSSSCP00000002625 ENSSSCP00000002625

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]