SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSSSCP00000003317 from Sus scrofa 69_10.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSSSCP00000003317
Domain Number 1 Region: 540-641
Classification Level Classification E-value
Superfamily PH domain-like 7.95e-24
Family Pleckstrin-homology domain (PH domain) 0.0028
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSSSCP00000003317   Gene: ENSSSCG00000003063   Transcript: ENSSSCT00000003400
Sequence length 646
Comment pep:known_by_projection chromosome:Sscrofa10.2:6:46234734:46260089:1 gene:ENSSSCG00000003063 transcript:ENSSSCT00000003400 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGTRSSPDEGTPPPAVPECNVEVQSQVAAQLREHPKDSGDQEGPEATVELPSGQGAEQQT
EEEEEVGEGSSTESSRDAAEAPPPVQTLGTPPAPTPSGEGVRGVARRLRAQQLEALTRVA
LMEQRVKELQRQRKELRIEMEVEVALLRGELAGERVAARREEEQLRELLGQQVDAEQGGQ
EQREQEQRQLSEERDHVEELRQRLREAQGQLDSQPEDQRERLLQGVQEMKEQLDVAQRAY
EDLEFQQLERESRREEEDKDSPGTRALDPKVQELQGSVAQHKGGAPQRRIQVLEEQLKSL
GEQMAAESRGLSQKKEEALQALTQERSRLLELSCPQGSPGREFPEPSQALTKLLFTQKTD
RQLLVLQDPTAHTATASSCLFSVHSSLQGSIGLQRTGSLSRKRGERGSQRGSPRPLSLHC
TGALEASALPPVAGDSGRYPLYQLLNCGPRNGCAALHPDIARMERLLKQALAERERLLQA
REGTRRSTEASSGPDVPAIKAPPTPPSGPSGPRVLDLRQHLERWGHNPENCPHVRVSGGC
CRGPLVKMGGRIKTWRKRWFCFDRQARRLAYYADKEETKLKGVIYFQAIEEVYYDHLRCA
FKSPNPRLTFCVKTYERLFYMVAPSPEAMRIWMDVIVTAADENHAP
Download sequence
Identical sequences ENSSSCP00000003317 ENSSSCP00000003317

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]