SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSSSCP00000003696 from Sus scrofa 69_10.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSSSCP00000003696
Domain Number 1 Region: 62-326
Classification Level Classification E-value
Superfamily Trypsin-like serine proteases 2.04e-77
Family Eukaryotic proteases 0.0000000545
Further Details:      
 
Domain Number 2 Region: 9-78
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.000000000000125
Family Complement control module/SCR domain 0.0000507
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSSSCP00000003696   Gene: ENSSSCG00000003410   Transcript: ENSSSCT00000003783
Sequence length 327
Comment pep:known chromosome:Sscrofa10.2:6:65145119:65150734:-1 gene:ENSSSCG00000003410 transcript:ENSSSCT00000003783 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MPECSIVDCGPPDDLQNGQVEYITAPEVTTYKAEMRYRCNAFYTMRIDHGKYVCEADGFW
MRSKGDKSLPVCEPVCGLSTRTTEGRIYGGQKAKLGDFPWQVLLFGETMAAGALVSDDWI
LTAAHAVYKQKEDASSLDIRLGVLKRLSPHYTQAWAEAIFIHEGYTHAGYDNDIALIKLK
DKVVINSNVMPICLPRKEAESFMRTNDIGTASGWGLTQRGFLARNLMSADLPIVDHQKCV
AAFEKKSDPGVRVTDNMLCAGLESGGKDSCKGDSGGALVFLDDETQKWFVGGIVSWSSTN
CGEAGQYGVYTKVINYIPWINNIINNF
Download sequence
Identical sequences ENSSSCP00000003696 ENSSSCP00000003696

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]