SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSSSCP00000003881 from Sus scrofa 69_10.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSSSCP00000003881
Domain Number 1 Region: 254-413
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 1.37e-47
Family Protein kinases, catalytic subunit 0.000000336
Further Details:      
 
Domain Number 2 Region: 144-284
Classification Level Classification E-value
Superfamily SH2 domain 2.02e-37
Family SH2 domain 0.00000858
Further Details:      
 
Domain Number 3 Region: 78-191
Classification Level Classification E-value
Superfamily SH3-domain 0.00000000000000105
Family SH3-domain 0.00034
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSSSCP00000003881   Gene: ENSSSCG00000003578   Transcript: ENSSSCT00000003972
Sequence length 419
Comment pep:known_by_projection chromosome:Sscrofa10.2:6:78326491:78358088:-1 gene:ENSSSCG00000003578 transcript:ENSSSCT00000003972 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGCVFCKKLEPGPKEDGGLEGDFRGYGAADHYGPDPTQGRPASSFSHIPNYNNFSPQPAS
PAFLDGATIRGISGTGVTMFIALYDYEARTEDDLTFTKGEKFHILNNTKNDWKGSLGLYK
TGRKGSGCVPKNWALPPETSQASLWYFGKIGRKDAERQLLSPGNPRGAFLIRESETTKGA
YSLSIRDWDQARGDHVKHYKIRKLDTGGYYITTRAQFDSVQELVQHYLEVNDGLCHLLTA
ACTTMKPQTLGLAKDAWEISRSSIALERRLGTGCFGDVWLGMWNGSTKVAVKTLKPGTMS
PKAFLAEAQIMKLLRHDKLVQLYAVVSEEPIYIVTEFMCHGSLLEFLKNREGQDLRLPHL
VDMAAQVAEGMAYMERMNYIHRDLRAANILVGERLVCKIADFGLARLIEDDEYNPQQGA
Download sequence
Identical sequences ENSSSCP00000003881 ENSSSCP00000003881

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]