SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSSSCP00000003912 from Sus scrofa 69_10.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSSSCP00000003912
Domain Number 1 Region: 231-500
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 1.89e-81
Family Protein kinases, catalytic subunit 0.000000000221
Further Details:      
 
Domain Number 2 Region: 122-265
Classification Level Classification E-value
Superfamily SH2 domain 4.17e-39
Family SH2 domain 0.00000144
Further Details:      
 
Domain Number 3 Region: 51-172
Classification Level Classification E-value
Superfamily SH3-domain 1.06e-22
Family SH3-domain 0.000043
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSSSCP00000003912   Gene: ENSSSCG00000003608   Transcript: ENSSSCT00000004003
Sequence length 509
Comment pep:known_by_projection chromosome:Sscrofa10.2:6:82843255:82852669:1 gene:ENSSSCG00000003608 transcript:ENSSSCT00000004003 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGCSCSSNPEDDWMENIDVCENCHYPIVPLDGKATLPMRNGSEVRDPLVTYEGSNPPASP
LQDNLVIALHSYEPSHDGDLGFEKGEQLRILEQNGEWWKAQSLTTGLEGFIPFNFVAKAN
SLEPEPWFFKNLSRKDAERQLLAPGNTHGSFLIRESESTAGSFSLSVRDFDQNQGEVVKH
YKIRNLDKGGFYISPRITFPGLHELVHHYTNSSDGLCTRLNRPCQTQKPQKPWWEDEWEV
PRETLKLVERLGAGQFGEVWMGYYNGHTKVAVKSLKQGSMSPDAFLAEANLMKQLQHQRL
VRLYAVVTQEPIYIITEYMENGSLVDFLKTSTGIKLTINKLLDMAAQIAEGMAFIEDRNY
IHRDLRAANILVSDTLSCKIADFGLARLIEDNEYTAREGAKFPIKWTAPEAINYGTFTIK
SDVWSFGILLTEIVTHGRIPYPGMTNTEVIQNLERGYRMVRPDNCPEELYHLMMLCWKER
PEERPTFDYLRSVLEDFFTATEGQYQPQP
Download sequence
Identical sequences F1SV94
XP_020948911.1.46622 XP_020948912.1.46622 ENSSSCP00000003912 ENSSSCP00000003912

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]