SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSSSCP00000004311 from Sus scrofa 69_10.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSSSCP00000004311
Domain Number 1 Region: 378-434
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.14e-23
Family Classic zinc finger, C2H2 0.006
Further Details:      
 
Domain Number 2 Region: 322-378
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.96e-21
Family Classic zinc finger, C2H2 0.0055
Further Details:      
 
Domain Number 3 Region: 477-529
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 7.53e-19
Family Classic zinc finger, C2H2 0.0023
Further Details:      
 
Domain Number 4 Region: 43-101
Classification Level Classification E-value
Superfamily KRAB domain (Kruppel-associated box) 1.44e-18
Family KRAB domain (Kruppel-associated box) 0.0021
Further Details:      
 
Domain Number 5 Region: 434-488
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 9.16e-18
Family Classic zinc finger, C2H2 0.0079
Further Details:      
 
Domain Number 6 Region: 283-335
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 3.02e-17
Family Classic zinc finger, C2H2 0.0047
Further Details:      
 
Domain Number 7 Region: 174-222
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000717
Family Classic zinc finger, C2H2 0.03
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSSSCP00000004311   Gene: ENSSSCG00000003990   Transcript: ENSSSCT00000004412
Sequence length 534
Comment pep:known_by_projection chromosome:Sscrofa10.2:6:57102604:57106521:1 gene:ENSSSCG00000003990 transcript:ENSSSCT00000004412 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
LLASPGPDVSGAAESVSRRIFMPPIASRCPLPALCRVPCGEARGCVISEGVFVYFSLEEW
KLLDEAQRRLYRDVMLENLALLASLGIASSRSHLVMQLQQGGGPWIPTQVAVTPAAEKEA
QQGPGPGCWCGVEGEVISSEHNDSLERVSQCHRTPMAHLKTYSCDVSDLSDPVFKDIRHL
TENQGGKASPEPRTCEACGKPFWFSADLHRHQKQQSGEKFFRTDEGRDSVKSCRTSVPDK
TCIHGESRMDLPATSGLHHWVPHSRIKPHKNTEFGETLSAGQKHHKCSECGKVFTRKDTL
ARHQRIHTGERPYECSKCGKFFSQSCDLFKHQTIHTGERPYECNECGKFFRQISGLIEHR
RVHTGERLYQCSNCGKFFSSKSNLIRHQEVHTGARPYVCNECGKEFNRKHTLILHQRTHT
GERPYECSECGKCFSQSSHLNVHWRIHSSDYECSRCGKAFSCISKLVQHQKVHSGEKPYE
CSKCGKAFTQRPNLIRHWKVHTGERPYVCSDCGKEFNRKHTLVLHQRIHIGEKP
Download sequence
Identical sequences ENSSSCP00000004311 ENSSSCP00000004311

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]