SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSSSCP00000004783 from Sus scrofa 69_10.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSSSCP00000004783
Domain Number 1 Region: 225-496
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 4.1e-82
Family Protein kinases, catalytic subunit 0.0000000766
Further Details:      
 
Domain Number 2 Region: 120-263
Classification Level Classification E-value
Superfamily SH2 domain 1.88e-41
Family SH2 domain 0.0000377
Further Details:      
 
Domain Number 3 Region: 40-167
Classification Level Classification E-value
Superfamily SH3-domain 2.49e-25
Family SH3-domain 0.00035
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSSSCP00000004783   Gene: ENSSSCG00000004434   Transcript: ENSSSCT00000004899
Sequence length 511
Comment pep:known_by_projection chromosome:Sscrofa10.2:1:91721730:91829805:-1 gene:ENSSSCG00000004434 transcript:ENSSSCT00000004899 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGNFCLRLRAYLEPYLPCLSREGADKPLGIRNPGAVCPPDPPPPAPKPVTSQGHYFVALF
DYQARTAEDLSFRAGDKLQVLDTSHEGWWLARHLEKRADGSGQLLQGYIPSNYVAEDRSL
QAEPWFFGAIKRADAEKQLLYPENQEGAFLIRESESQKGDFSLSVLHEGIVKHYRIRRLD
EGGFFLTRRRTFSTLNEFVSHYSRTSDGLCVKLGKPCLKIQVPATIDLSYKTADQWEIDR
NSIQLLKRLGSGQFGEVWEGLWNNTTPVAVKTLKPGSMDPNDFLREAQIMKNLRHPKLIQ
LYAVCTLEDPIYIITELMRHGSLQEYLQNDAGSKIHLTQQVDMAAQVASGMAYLESQNYI
HRDLAARNVLVGEHNIYKVADFGLARVFKVDNEDIYESKHEIKLPVKWTAPEAIRANKFS
IKSDVWSFGVLLYEIITYGKMPYSGMTGAQVIQMLGQNYRLPQPANCPPEFYNIMLECWN
EEPKERPTFEMLHWKFEDYFDIDSSYSDTNN
Download sequence
Identical sequences F1RZK6
ENSSSCP00000004783 XP_001925827.2.46622 ENSSSCP00000004783 9823.ENSSSCP00000004783

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]