SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSSSCP00000005075 from Sus scrofa 69_10.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSSSCP00000005075
Domain Number 1 Region: 11-103
Classification Level Classification E-value
Superfamily Retrovirus capsid dimerization domain-like 2.88e-40
Family SCAN domain 0.0000523
Further Details:      
 
Domain Number 2 Region: 739-795
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 5.01e-24
Family Classic zinc finger, C2H2 0.0052
Further Details:      
 
Domain Number 3 Region: 682-739
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 5.2e-24
Family Classic zinc finger, C2H2 0.0046
Further Details:      
 
Domain Number 4 Region: 780-832
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.24e-18
Family Classic zinc finger, C2H2 0.0061
Further Details:      
 
Domain Number 5 Region: 634-683
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000000715
Family Classic zinc finger, C2H2 0.014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSSSCP00000005075   Gene: ENSSSCG00000004709   Transcript: ENSSSCT00000005201
Sequence length 848
Comment pep:known_by_projection chromosome:Sscrofa10.2:1:142941221:142951245:1 gene:ENSSSCG00000004709 transcript:ENSSSCT00000005201 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MMAKPTLRGTGTNSETFRQRFRRFHYQEVAGPREAFSQLWQLCCRWLRPEVRTKEQIVEL
LVLEQFLTILPGEIQNWVQKQCPESGEEAVALVEDLEREPGRPGHSVTVSMKGQEVRLEK
MTPLKSSRELLSVLQESVEPQPRGVPKKERARSSDLGPREQMNPQEKLRPFQRSGLPFSK
SMVSKLEQGEPWIPDLGSKEKELPRGRHTGDRQLHADLLPSSRERKSRVEQDHWGFEDEK
VAGVHWGYEETRTLLAILSQTEFYEALRNCHRNSQVYEAVAERLREYGFLRTLEQCRTKF
KGLQKSYRKVKSGHPPETCPFFEEMEALMSAQVIALPSNGLEEAASHSGLVASDAETEEP
EQEGWQHEDRGEAMAEESDSDEVGQEATPQDTDNSTTPVLFRSPSGVHWGYEETKTYLAI
LSETQFYEALRNCHRNSQLYGAVAERLWEHGFLRTPEQCRTKFKSLQTSYRKVKNGQAPE
TCPFFEEMDALVSAGVAAQPSDGQEEEAGSCPIQTSEAEAEKQAEEADEAIEDSEDDDED
TEVPPEAVTRAPVLFQSPSGFEAGFENEENQKQDISEEVQLHRTLLARSERKIPRHLNQG
RGSESECRSGKQWEKIPWERRGKPTFPEKSLGKVLSHQKAYLGERPYKYLRYGKSFGPNA
HLMHQIAHQVENPYKCDDCGKSFSRSARLIRHRRIHTGEKPYKCLDCGKSFRDSSNFITH
RRIHTGEKPYQCGECGKRFNQSSSLIIHQRTHTGEKPYQCEECGKSFNNSSHFSAHRRIH
TGERPHVCPDCGKSFSKSSDLRAHHRTHTGEKPYGCHDCGKYFSKSSALNKHREIHAREK
LLSQVAPK
Download sequence
Identical sequences 9823.ENSSSCP00000005075 ENSSSCP00000005075 ENSSSCP00000005075

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]