SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSSSCP00000007421 from Sus scrofa 69_10.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSSSCP00000007421
Domain Number 1 Region: 233-290
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 6.05e-26
Family Classic zinc finger, C2H2 0.003
Further Details:      
 
Domain Number 2 Region: 121-178
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 3.34e-24
Family Classic zinc finger, C2H2 0.0047
Further Details:      
 
Domain Number 3 Region: 177-234
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.85e-22
Family Classic zinc finger, C2H2 0.0056
Further Details:      
 
Domain Number 4 Region: 275-327
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 5.48e-19
Family Classic zinc finger, C2H2 0.0064
Further Details:      
 
Domain Number 5 Region: 83-135
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 4.36e-17
Family Classic zinc finger, C2H2 0.0063
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSSSCP00000007421   Gene: ENSSSCG00000006959   Transcript: ENSSSCT00000007624
Sequence length 334
Comment pep:known_by_projection chromosome:Sscrofa10.2:4:1444379:1445383:-1 gene:ENSSSCG00000006959 transcript:ENSSSCT00000007624 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MPQQAALGEGGFHGEAVPGLFQGPPQAPGFLDPCAKEEAEERPGLAVDEETGGPSGREDS
MSGSEVTLHTGHVTDGRGPWKGRPYQCSTCDRSFKCYSDAVKHQSIHSGEKPYECSDCGK
AFIHSSHVVRHQRTHNGERPYICKECGKAFSQSFNLVRHQRSHTGEKPYGCAECGKSFGQ
RSDAVKHRRIHTGERLYECSDCGKTFIHSSNVVRHQRIHHGENPYECKECGKAFSQSSNL
IQHQRVHTGEKPYACQECGRAFSRSSFLSEHRRIHTGEKPYECSECGRAFRALSGFFRHQ
RIHTGEKPFRCAECGRAFRLSFHLIQHRRVHGTE
Download sequence
Identical sequences F1SEV3
ENSSSCP00000007421 ENSSSCP00000007421

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]