SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSSSCP00000008698 from Sus scrofa 69_10.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSSSCP00000008698
Domain Number 1 Region: 135-198
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 9.27e-19
Family LIM domain 0.0011
Further Details:      
 
Domain Number 2 Region: 74-138
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 3.44e-16
Family LIM domain 0.0037
Further Details:      
 
Domain Number 3 Region: 13-75
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 0.0000000000000394
Family LIM domain 0.036
Further Details:      
 
Domain Number 4 Region: 194-242
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 0.000000000008
Family LIM domain 0.0012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSSSCP00000008698   Gene: ENSSSCG00000008147   Transcript: ENSSSCT00000008924
Sequence length 287
Comment pep:known_by_projection chromosome:Sscrofa10.2:3:51610400:51640594:-1 gene:ENSSSCG00000008147 transcript:ENSSSCT00000008924 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
QKSSTKMTERFDCHHCENSLFGRKYVLREEQPYCVGCFEALFASTCEECGKLIGCDCKDL
SYKDRHWHEACFHCSRCRSSLVDKPFAAKEDQVLCTDCYSQEYSSRCQECRKAIMPGTRK
MEYKGSSWHETCFTCHRCQQPIGTKSFIPKDGQNFCVPCYEKQHALQCIQCKKPITSGGV
TYREQPWHRECFVCTACKKPLSGQRFTSRDEFAYCLGCFCDLYAKKCTGCANPISGECPG
APPLPLKVKKAWGRWCLQAPRLCCSMSSRGSVVSERELLCPDCGKDI
Download sequence
Identical sequences ENSSSCP00000008698 ENSSSCP00000008698 9823.ENSSSCP00000008698

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]