SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSSSCP00000009164 from Sus scrofa 69_10.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSSSCP00000009164
Domain Number 1 Region: 609-835
Classification Level Classification E-value
Superfamily Kelch motif 1.44e-52
Family Kelch motif 0.00018
Further Details:      
 
Domain Number 2 Region: 335-458
Classification Level Classification E-value
Superfamily POZ domain 5.89e-27
Family BTB/POZ domain 0.0027
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSSSCP00000009164   Gene: ENSSSCG00000008593   Transcript: ENSSSCT00000009404
Sequence length 842
Comment pep:known_by_projection chromosome:Sscrofa10.2:3:122136104:122272144:-1 gene:ENSSSCG00000008593 transcript:ENSSSCT00000009404 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
CRSSKSLLSALCQQVRPLFPREEQPRPTEMSRHHSRFERDYRVGWDRREWSANGTHGTTS
ICSATAGAGGSTASSLSARPGLLPLPVVPSRLPTPATAPAPCTTGSGEAITSLVASSASA
VTTKAPGISKADNQSQGLTTSIRWGQTPINQSTPWDTDEPPSKQMRESDNPGTGPWGTTV
ATGSQPALIAHSYGVAQPPTFSPAVNVQAPVIGVTPSLPPHVGPQLPLMPGHYSLPQPPS
QPLSSVVVNMPAQALYASPQPLAVSTLPGVGQVARPGPTAVGNGHMAGPLLPPPPPAQPS
ATLPSGAPATNGPPTSDSAHGLQMLRTIGVGKYEFTDPGHPKEMLKELNQQRRAKAFTDL
KIVVEGREFEVHQNVLASCSLYFKDLIQRSVQDGSQCGREKLELVLSNLQADVLELLLEF
VYTGSLVIDSANAKTLLEAASKFQFHTFCKVCVSFLEKQLTASNCLGVLAMAEAMQCSEL
YHMAKAFALQIFPEVAAQEEILSISKDDFIAYISNDSLNTKAEELVYETVIKWIKKDPGS
RAQYAAELLAVVRLPFIHPSYLLNVVDNEELIKSSEACRDLVNEAKRYHMLPHARQEMQT
PRTRPRLSAGGMESGVTLADVWCYMSLLDNWNLVSRMTVPRCRHNSLVYDGKIYTLGGLG
VAGNVDHVERYDTITNQWEAVAPLPKAVHSAAATVCGGKIYVFGGVNEAGRAAGVLQSYV
PQTNTWSFIESPMIDNKYAPAVTHGFVFILGGAYARATTIYDPDKGNIKAGPNMNHSRQF
CSAVVLDGKIYATGGIVSSEGPALGNMEAYEPATNTWTLLPHMPCPVFRHGCVVIKKYIQ
SG
Download sequence
Identical sequences ENSSSCP00000009164 ENSSSCP00000009164

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]