SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSSSCP00000009400 from Sus scrofa 69_10.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSSSCP00000009400
Domain Number 1 Region: 237-507
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 2.53e-80
Family Protein kinases, catalytic subunit 0.0000000159
Further Details:      
 
Domain Number 2 Region: 63-143
Classification Level Classification E-value
Superfamily SH3-domain 2.44e-19
Family SH3-domain 0.00028
Further Details:      
 
Domain Number 3 Region: 121-230
Classification Level Classification E-value
Superfamily SH2 domain 0.000000171
Family SH2 domain 0.0006
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSSSCP00000009400   Gene: ENSSSCG00000008819   Transcript: ENSSSCT00000009649
Sequence length 511
Comment pep:known scaffold:Sscrofa10.2:JH118570.1:46427:84315:-1 gene:ENSSSCG00000008819 transcript:ENSSSCT00000009649 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
RQVRTQISLSSDEELSEKYTQRRRPWFSELPIKKHSNRGRVQPSKRKPLPPLPPSEFVEE
KIKVKALYDFLPREPYDLALKRAEEYLILEKYNPHWWKARDRLGNEGLIPSNYVTENKPT
NLEIYEWYHRNITRNQAEHLLRQESELETRIYCIDDLSKYLILFHISIVNGSNRSKIKRF
FKHFQIKVNLKSLAWIIFEFYIFEFLRQLTWYKHHSGNSSRLMSRLRYPVGLMGSCLPAT
AGFSYEKWEIDPSELAFVKEIGSGQFGVVYLGQWRAHVQVAIKAINEGSMSEEDFIEEAK
VMTKLSHSRLVQLYGVCIQRKPLYIVTEFMEHGCLLNYLRERKGKLKKEMLLSVCQDICE
GMEYLERNCFIHRDLAARNCLVSSTSIVKISDFGMTRYVLDDEYISSSGAKFPVKWSPPE
VFHFNKYSSKSDVWSFGVLMWEVFTEGKMPFENKSNLQVVEAISKGFRLYRPQLAPMAIY
EVMYSCWHEKPKGRPTFAELLQILTEIAETW
Download sequence
Identical sequences ENSSSCP00000009400 ENSSSCP00000027599

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]