SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSSSCP00000010004 from Sus scrofa 69_10.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSSSCP00000010004
Domain Number 1 Region: 161-327
Classification Level Classification E-value
Superfamily (Phosphotyrosine protein) phosphatases II 8.57e-43
Family Dual specificity phosphatase-like 0.0000123
Further Details:      
 
Domain Number 2 Region: 339-471
Classification Level Classification E-value
Superfamily C2 domain (Calcium/lipid-binding domain, CaLB) 9.15e-38
Family PLC-like (P variant) 0.0025
Further Details:      
 
Domain Number 3 Region: 20-155
Classification Level Classification E-value
Superfamily Voltage-gated potassium channels 0.00000345
Family Voltage-gated potassium channels 0.028
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSSSCP00000010004   Gene: ENSSSCG00000009374   Transcript: ENSSSCT00000010271
Sequence length 472
Comment pep:known chromosome:Sscrofa10.2:11:15846681:15896910:-1 gene:ENSSSCG00000009374 transcript:ENSSSCT00000010271 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
NICSYCSTIRRIVHLIVSSFTFRIFGILLIFVDVFLIVTDLLATDSTHSIPIEYRSISLA
IAMYFLMEVCLRVFIDGIRPYFSDIFNFLDAAVIVVTLLVDIVYIFYDFKSLKDISKLTF
FFRPLRLIILLRVFHLVHQKKHLEILARRVVSENKRRYKKNGFDLDLTYVTDRVIAMSFP
SSGKQSLYRNPIEEVVRFLDTKHQNHYQVYNLCSENAYDPKNFHHRVQRYMIDDHNVPTL
SEMLAFSKNVQEWMAQDEENVIAVHCKGGKGRTGTMICAYLLASEIFTTAEASCYYFGER
RTDKSTSSKFQGIETPSQNRFVGYFAKVKNSFNMTLPLRKILTIKKIIIYSIHGVGTGNG
NDLKVQIIMQQKTVFSGSASQNCRMVHDAETDRVIFNLLSCPPLYDEVKVKFLSSNLPKY
YDNCPFFFWFHTSFIQNNRLYLPRSELDNPHKPRAWKIYRPDFAVEVHFDEV
Download sequence
Identical sequences ENSSSCP00000010004 ENSSSCP00000010004

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]