SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSSSCP00000010076 from Sus scrofa 69_10.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSSSCP00000010076
Domain Number 1 Region: 341-599
Classification Level Classification E-value
Superfamily Kelch motif 6.8e-40
Family Kelch motif 0.00093
Further Details:      
 
Domain Number 2 Region: 42-166
Classification Level Classification E-value
Superfamily POZ domain 4.91e-33
Family BTB/POZ domain 0.0017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSSSCP00000010076   Gene: ENSSSCG00000009437   Transcript: ENSSSCT00000010344
Sequence length 680
Comment pep:known_by_projection chromosome:Sscrofa10.2:11:26572065:26574107:-1 gene:ENSSSCG00000009437 transcript:ENSSSCT00000010344 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MQSREEASRSRRLASPRGGRRPKRISKPSVSAFFTGSEELKDTAHSAALLAQLKSFYDAR
LLCDVTIEVVTPGSGPGTGRLFSCNRNVLAAACPYFKSMFTGGMYESHQTNVTMHDVDAE
SFEVLVDYCYTGRVSLSEANVQRLYAASDMLQLEYVREACASFLARRLDLANCTAILKFA
DAFDHHKLRSQAQSFIAHNFKQLSRMGSIREESLADLTLAQLLAVLRLDSLDIESERTVC
HVAVQWLEAAPKERGPSAAEVFKCVRWTHFTDKDREYLEGLLTKPIVKKYCLDLMEGVLQ
MRYGDMLYKSLVPKPESSSGNSVVSIAENPPQRLGMCAKEMVIFFGHPRDPFLCYDPYSG
DIYTMPSPLTSLAHTKTITSSAVCVSPDHDIYLAAQPRKDLWVYKPAQNSWQQLADRLLC
REGMDVAYLNGYIYILGGRDPVTGVKLKEVECYSVQRNQWALVAPVPHSFYSFELIVVQN
YLYAVNSKRMLCYDPSHNMWLNCASLKRSDFQEACVFNDEIYCICDIPVMKVYNPARGEW
RRISNIPLDSETHNYQIVNHGQKLLLITSTTPQWKKNRVTVYEYDTREDQWINIGTMLGL
LQFDSGFICLCARVYPSCLEPGQSFITEEDDARSESSTEWDLDGFSELDSESGSSSSFTD
DEVWVQVAPQRNAQDQQGSL
Download sequence
Identical sequences 9823.ENSSSCP00000010076 ENSSSCP00000010076 ENSSSCP00000010076

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]