SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSSSCP00000010077 from Sus scrofa 69_10.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSSSCP00000010077
Domain Number 1 Region: 42-166
Classification Level Classification E-value
Superfamily POZ domain 1.08e-33
Family BTB/POZ domain 0.0018
Further Details:      
 
Domain Number 2 Region: 366-476
Classification Level Classification E-value
Superfamily Kelch motif 0.00000000000301
Family Kelch motif 0.007
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSSSCP00000010077   Gene: ENSSSCG00000009438   Transcript: ENSSSCT00000010345
Sequence length 477
Comment pep:known_by_projection chromosome:Sscrofa10.2:11:26509223:26510653:-1 gene:ENSSSCG00000009438 transcript:ENSSSCT00000010345 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MQSREEASRSRRLASPRGGKRPKRVHKPTVSAFFTGPEELKDTAHSAALLAQLKSFYDAR
LLCDVTIEVVTPGSGPGTGRLFPCNRNVLAAACPYFKSMFTGGMYESHQTNVTMHDVDAE
SFEVLVDYCYTGRVSLSESNVERLYAASDMLQLEYVREACASFLARRLDLANCTAIFKFA
DAFGHRKLRSQAQSFIAHNFKQLSQMGSIREESLADLTLAQLLTVLRLDSLNIEHEQTVC
HVAVQWLEAAPKERGPSAAEVFKCVRWTHFTDEDRNYLEELLTKPIVKKYCLDLMEGALQ
MRYGDMLYKSLVPKPESSSACSSSSNNNNSSGGGSGVGCGGSSSSCSVVSVAENPPQRLG
VCAKKMVIFFGHPRDPFLCCDPYSGDIYKVPSPLTCLAHTRTVTTLAVCVSPDHDIYLAA
QPRKDLWVYKPAQNSWQQLADRLLCREGMDVAYLNGYIYILGGRDPITGIKLKEVEC
Download sequence
Identical sequences ENSSSCP00000010077 ENSSSCP00000010077

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]