SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSSSCP00000010217 from Sus scrofa 69_10.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSSSCP00000010217
Domain Number 1 Region: 232-279
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 7.7e-17
Family TRASH domain 0.0006
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSSSCP00000010217   Gene: ENSSSCG00000009568   Transcript: ENSSSCT00000010489
Sequence length 417
Comment pep:known_by_projection chromosome:Sscrofa10.2:11:86976089:87004308:-1 gene:ENSSSCG00000009568 transcript:ENSSSCT00000010489 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MCYRFISTARCSVGGSDLAEQTPVLLGSRAMATSLTDIGNSFDDPTSPLVKRSRNSSMED
DDDVVFVESIQPPSASAPVVTDQGNFAATEKETLQGNYSLMLPSSRDLASQKGKISETIV
IDDEEDIETNGKEKKISSSFIEWVLPETKNRTKDLDFSTSSLSRSKTKTAVGPFNPGRMN
GAGDEFQNGEFAAHHNPDSWISQSASFPRNQKQRGVDSLTPVASLPKQIFQPSVQQQPPK
PPKITCANCKNPLQKGQTAYQRKGSAHLFCSTSCLSSFSLKRTAKKRITSKKDAPTKKAT
VVPQMESSETFHQFCKTSSVSPCEDIQNLSKRVLNKSRCTICSNLTEIRHEVSVNNVTHK
LCSNQCFNKYRLANGLIMNCCEQCGQYLASKGAGNILVVEDQQMRFCCPSCVNEYKQ
Download sequence
Identical sequences ENSSSCP00000010217 ENSSSCP00000010217

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]