SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSSSCP00000011916 from Sus scrofa 69_10.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSSSCP00000011916
Domain Number 1 Region: 462-519
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 3.35e-25
Family Classic zinc finger, C2H2 0.0062
Further Details:      
 
Domain Number 2 Region: 350-407
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 8.89e-25
Family Classic zinc finger, C2H2 0.0066
Further Details:      
 
Domain Number 3 Region: 406-463
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.15e-22
Family Classic zinc finger, C2H2 0.0078
Further Details:      
 
Domain Number 4 Region: 300-351
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 3.51e-21
Family Classic zinc finger, C2H2 0.0038
Further Details:      
 
Domain Number 5 Region: 506-566
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.23e-20
Family Classic zinc finger, C2H2 0.0061
Further Details:      
 
Weak hits

Sequence:  ENSSSCP00000011916
Domain Number - Region: 124-173
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.000142
Family Classic zinc finger, C2H2 0.034
Further Details:      
 
Domain Number - Region: 214-273
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.000144
Family Classic zinc finger, C2H2 0.016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSSSCP00000011916   Gene: ENSSSCG00000011168   Transcript: ENSSSCT00000012230
Sequence length 593
Comment pep:known chromosome:Sscrofa10.2:10:76637930:76640563:-1 gene:ENSSSCG00000011168 transcript:ENSSSCT00000012230 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
CCIPYLVFWLSKIITPMKVEFLSLLHPEDYRDDNLIKRNKKIKDKQLQQVILIHSKPLPR
EEKEVLRKSFIQHVTPVSSTKMPCKYDSWGVNFQNVSQLIINNRKYSTKKTDCCNVCEDL
SFRIKFERTHTGEKFHEYNTNRGTLSYKENLPKHQKCQTLKQSFEFNEIGKGFYGEAACV
KYKSTHTEHSCKDNEFRKNYDKTILLDYERTGTGEKYSHLTQCGKSFCKKSVVKEYTKFN
MTVKHHECITNGNNFSRKSYLTQPQRTVTGENPLVCNVRKQTEDKPFEYHENRKSCPITA
HKVHQRIHAEVKPYKCNECGKSFCQKGHLIQHQRTHTGEKPFECNECGKTFSQKSHLSTH
QRIHTAEKPYKCNDCGKTFVQKSTLRGHQRIHTGEKPYECCECGKTFVQKSTLRDHHRIH
TGEKSFQCNECGKTFGQKSNLRIHQRTHSGEKTYQCKECEKSFWRKDHLIQHQKTHTGEK
PFKCNDCGKTFARTSTLRVHQRIHTGEKPFKCNECGKKFVRKAILSDHQRIHTGEKPFQC
YKCGKTFGQKSNLRIHQRTHSGEESYEWNEYGKLPKKSTLNVCQRIQGGEKPY
Download sequence
Identical sequences ENSSSCP00000011916 ENSSSCP00000011916

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]