SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSSSCP00000012082 from Sus scrofa 69_10.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSSSCP00000012082
Domain Number 1 Region: 416-476
Classification Level Classification E-value
Superfamily PH domain-like 0.00000799
Family PreBEACH PH-like domain 0.017
Further Details:      
 
Weak hits

Sequence:  ENSSSCP00000012082
Domain Number - Region: 51-131
Classification Level Classification E-value
Superfamily ARM repeat 0.0863
Family Armadillo repeat 0.054
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSSSCP00000012082   Gene: ENSSSCG00000011330   Transcript: ENSSSCT00000012406
Sequence length 493
Comment pep:known chromosome:Sscrofa10.2:13:33246447:33249295:1 gene:ENSSSCG00000011330 transcript:ENSSSCT00000012406 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MMLESALTDIREAPLGVLASLTQQALWLLRLLQDFLCAEGHGNQELWSEKLFEGVCSLLD
RLGAWPHLANGTADFREMAQIGLRLVLGYILLEDPQLHAQAYVKLHALLQTTVPMRREEA
CYVLSKLEAALARALSTLPSENPAGVEEPPAAATAAERCSWLVPLVRTLLDRAYGPLGLQ
WGLPSLPPTNGSPTFFEDFQAFCATPEWRHFIDKQVQPTMSQFEMDTYAKSHDLMSGFWN
ACYDMLMSSGQRRQRERAHSRRAFQELVLESAQRRARLEGLRYLAALKQQAAQHSTALLH
WGALWRQLSSPCGPWALRDPPTPHWKLSSAETYSRMRLKLVPNHHFNPHLEASALRDNLG
EAPLTPTEEASLPLAVTKEAKVSTLPEELQEDQLGEDELAALETALEAAELDEQHEKLVL
SAECQLVTVVAVVPGLLEVTTQHVYFYDGSAERVETEEGIGHDFRRPLAQLREVHSGVSP
APSALELSSLIRH
Download sequence
Identical sequences ENSSSCP00000012082 ENSSSCP00000012082

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]