SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSSSCP00000012188 from Sus scrofa 69_10.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSSSCP00000012188
Domain Number 1 Region: 474-766
Classification Level Classification E-value
Superfamily L domain-like 9.86e-50
Family Ngr ectodomain-like 0.03
Further Details:      
 
Domain Number 2 Region: 43-428
Classification Level Classification E-value
Superfamily L domain-like 2.3e-39
Family Internalin LRR domain 0.044
Further Details:      
 
Domain Number 3 Region: 862-1014
Classification Level Classification E-value
Superfamily Toll/Interleukin receptor TIR domain 1.01e-26
Family Toll/Interleukin receptor TIR domain 0.00026
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSSSCP00000012188   Gene: ENSSSCG00000011436   Transcript: ENSSSCT00000012516
Sequence length 1030
Comment pep:known chromosome:Sscrofa10.2:13:37647229:37652020:1 gene:ENSSSCG00000011436 transcript:ENSSSCT00000012516 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGPRCTLHPLSLLVQVTALAAALAQGRLPAFLPCELQPHGLVNCNWLFLKSVPHFSAAAP
RANVTSLSLLSNRIHHLHDSDFVHLSSLRTLNLKWNCPPAGLSPMHFPCHMTIEPNTFLA
VPTLEELNLSYNSITTVPALPDSLVSLSLSRTNILVLDPTHLTGLHALRYLYMDGNCYYK
NPCQGALEVVPGALLGLGNLTHLSLKYNNLTEVPRSLPPSLETLLLSYNHIVTLTPEDLA
NLTALRVLDVGGNCRRCDHARNPCRECPKDHPKLHSDTFSHLSRLEGLVLKDSSLYNLDT
RWFRGLDRLQVLDLSENFLYDCITKTTAFQGLARLRSLNLSFNYHKKVSFAHLHLAPSFG
HLRSLKELDMHGIFFRSLSETTLQPLVQLPMLQTLRLQMNFINQAQLSIFGAFPGLLYVD
LSDNRISGAARPVAITREVDGRERVWLPSRNLAPRPLDTLRSEDFMPNCKAFSFTLDLSR
NNLVTIQSEMFARLSRLECLRLSHNSISQAVNGSQFVPLTSLRVLDLSHNKLDLYHGRSF
TELPRLEALDLSYNSQPFTMQGVGHNLSFVAQLPALRYLSLAHNDIHSRVSQQLCSASLC
ALDFSGNDLSRMWAEGDLYLRFFQGLRSLVWLDLSQNHLHTLLPRALDNLPKSLKHLHLR
DNNLAFFNWSSLTLLPKLETLDLAGNQLKALSNGSLPSGTQLRRLDLSGNSIGFVNPGFF
ALAKQLEELNLSANALKTVEPSWFGSMVGNLKVLDVSANPLHCACGATFVGFLLEVQAAV
PGLPSRVKCGSPGQLQGHSIFAQDLRLCLDETLSWNCFGISLLAMALGLVVPMLHHLCGW
DLWYCFHLCLAWLPHRGQRRGADALFYDAFVVFDKAQSAVADWVYNELRVQLEERRGRRA
LRLCLEERDWLPGKTLFENLWASVYSSRKTLFVLAHTDRVSGLLRASFLLAQQRLLEDRK
DVVVLVILRPDAYRSRYVRLRQRLCRQSVLLWPHQPRGQGSFWAQLGTALTRDNHHFYNR
NFCRGPTTAE
Download sequence
Identical sequences Q5I2M3
ENSSSCP00000012188 ENSSSCP00000012188

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]