SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSSSCP00000012866 from Sus scrofa 69_10.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSSSCP00000012866
Domain Number 1 Region: 760-814
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 5.33e-17
Family Classic zinc finger, C2H2 0.01
Further Details:      
 
Domain Number 2 Region: 844-899
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000000000078
Family Classic zinc finger, C2H2 0.038
Further Details:      
 
Domain Number 3 Region: 432-480
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000000000774
Family Classic zinc finger, C2H2 0.023
Further Details:      
 
Domain Number 4 Region: 597-646
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000000000916
Family Classic zinc finger, C2H2 0.019
Further Details:      
 
Domain Number 5 Region: 520-571
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.000000000978
Family Classic zinc finger, C2H2 0.013
Further Details:      
 
Domain Number 6 Region: 687-737
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.000000726
Family Classic zinc finger, C2H2 0.033
Further Details:      
 
Domain Number 7 Region: 805-846
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.000000888
Family Classic zinc finger, C2H2 0.023
Further Details:      
 
Domain Number 8 Region: 889-940
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000326
Family Classic zinc finger, C2H2 0.046
Further Details:      
 
Weak hits

Sequence:  ENSSSCP00000012866
Domain Number - Region: 114-229
Classification Level Classification E-value
Superfamily SET domain 0.00114
Family Histone lysine methyltransferases 0.052
Further Details:      
 
Domain Number - Region: 490-514
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00272
Family Classic zinc finger, C2H2 0.03
Further Details:      
 
Domain Number - Region: 244-284
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00362
Family Classic zinc finger, C2H2 0.05
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSSSCP00000012866   Gene: ENSSSCG00000012084   Transcript: ENSSSCT00000013218
Sequence length 1201
Comment pep:known_by_projection chromosome:Sscrofa10.2:13:215498995:215544157:-1 gene:ENSSSCG00000012084 transcript:ENSSSCT00000013218 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
VAEMAEDGSEEIMFIWCEDCSQYHDSECPELGPVVMVKDSFVLSRASLLPARGRGLGAPG
LDAGQGRPHLCSRPIPAVPPDTSWECGGLSGPTRGTSSWSLWSPTLSLGVSSLPSNLEIR
RLEDGAEGVFAVTQLVKRTQFGPFESRRVAKWEKESAFPLKVFQKDGHPVCFDTSNEDDC
NWMMLVRPAAEPGHQNLTAFQHGSDVYFTTSRDIPPGTELRVWYAAFYAKRMDKPMLRQA
CPGLHAAGTPENSTPVESEPSQWVCKVCSATFPELQLLNEHLLGHLEQTKNVPPASQQES
APEKEAEAPRGEPPAVPKSVSAAKEQKKKPRRGRKPKASKPEQPLVIVEGKEPAEHVAEI
MTEVEPVTSTTTDERIMELVLGKLATTPTDASSVPKFPHHQGSTITLKRSLILSGRPGIR
RKLVRQLGEHRRVYQCSLCSKIFQNSSNLSRHVRSHGDKLFKCEECAKLFSRKESLKQHV
SYKHSRNEVDGEYRYRCGTCEKTFRIESALEFHNCRTDDKTFQCEMCFRFFSTNSNLSKH
KKKHGDKKFACEVCNKMFYRKDVMLDHQRRHLEGVRRVKREDAEAGGNLLRYRKEPSGCP
VCGKVFSCRSNMNKHLLTHGDKKYTCEICGRKFFRVDVLRDHIHVHFKDIALMDDHQRAE
FIGKIGISSEENDDNSDESADSEPHKYSCKRCQLTFGRGKEYLKHIMETHKEKGYGCSIC
NRRFALKATYHAHMVIHRENLPDPNVQKYIHPCEICGRIFNSIGNLERHKLIHTGVKSHA
CEQCGKSFARKDMLKEHMRVHDNIREYLCAECGKGMKTKHALRHHMKLHKGIKEYECREC
HRKFAQKVNMLKHYKRHTGIKDFMCELCGKTFSERNTMETHKLIHTVGKQWTCSVCDKKY
VTEYMLQKHVQLTHDKVEAQSCQLCGTKVSTRASMSRHMRRKHPEVLAVRIDDLDHLPET
TTIDASSIGIVQPELSLEQEDLAEGKHAKGARRTHKRKQKPEEEAGAAGAEDASFSEFSE
KEAPFPGGVGDETDSAVQSIQQVVVTLGDPNVTAPSSSVGLTNITVTPITTTAGTQFTNL
QPVAVGHLTTPERQLQLDNSILTVTFDTVSGSAMLHNRQNDLQIHPQPEASNPQSVAHFI
NLTTLVNSITPLGSQLGEQHPLTWRAVPQTDVLPPPQPQAPPPQAPQPQGPAEQQPQMYS
Y
Download sequence
Identical sequences ENSSSCP00000012866 ENSSSCP00000012866

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]