SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSSSCP00000013266 from Sus scrofa 69_10.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSSSCP00000013266
Domain Number 1 Region: 430-713
Classification Level Classification E-value
Superfamily Kelch motif 3.53e-81
Family Kelch motif 0.00000148
Further Details:      
 
Domain Number 2 Region: 163-277
Classification Level Classification E-value
Superfamily POZ domain 1.73e-31
Family BTB/POZ domain 0.0019
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSSSCP00000013266   Gene: ENSSSCG00000012467   Transcript: ENSSSCT00000013634
Sequence length 718
Comment pep:known_by_projection chromosome:Sscrofa10.2:X:80884837:81001424:1 gene:ENSSSCG00000012467 transcript:ENSSSCT00000013634 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSVSGKKEFDVKQILRLRWRWFSHPSQGSPNTGNCLQQEGYEHRGTPVQGRLKSHPRDRN
GLKKSNSPVHHSILAPVPGPAPAHQRALQNWHPQNLIEHLQANEDTPKAVPEENLFKKSC
EKHSQDLEMMADDNTEDSTARLDTQHPKEMNVSRSEEQFHAVNHAEQTLHKMENYLKDKQ
LCDVLLIAGHLRIPAHRLVLSAVSDYFAAMFTNDVLEAKQEEVKMEGIDPNALNSLVQYA
YTGVLQLKEDTIENLLAAACLLQLTQVVEVCSNFLIKQLHPSNCLGIRSFGDAQGCTELL
SVAHKYTMEHFIEVIKNQEFLLLPANEISKLLCSDDINVPDEETIFHALMQWVGHDAQAR
QQDLAMLLSYIRLPLLPPQLLADLENSSMFTGDLECQKLLMEAMKYHLLPERRPMMQSPR
TKPRKSTVGALYAVGGMDAMKGTTTIEKYDLRTNSWLHIGTMSGRRLQFGVAVIDNKLYV
VGGRDGLKTLNTVECFNPVGKIWTVMPPMSTHRHGLGVATLEGPMYAVGGHDGWSYLNTV
ERWDPEGRQWNYVASMSTPRSTVGVVALNNKLYAIGGRDGSSCLRSMEYFDPHTNKWSLC
APMSKRRGGVGVATYNGFLYVVGGHDAPASNHCSRLSDCVERYDPKNDSWSTVAPLSVPR
DAVAVCPLGDKLYVVGGYDGHTYLNTVESYDAQKDEWKEEVPVNIGRAGACVVVETIS
Download sequence
Identical sequences ENSSSCP00000013266 ENSSSCP00000013266

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]