SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSSSCP00000014342 from Sus scrofa 69_10.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSSSCP00000014342
Domain Number 1 Region: 227-478
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 5.6e-72
Family Protein kinases, catalytic subunit 0.000000105
Further Details:      
 
Domain Number 2 Region: 116-251
Classification Level Classification E-value
Superfamily SH2 domain 4.17e-31
Family SH2 domain 0.00000178
Further Details:      
 
Domain Number 3 Region: 51-139
Classification Level Classification E-value
Superfamily SH3-domain 0.0000000000984
Family SH3-domain 0.0015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSSSCP00000014342   Gene: ENSSSCG00000013494   Transcript: ENSSSCT00000014740
Sequence length 506
Comment pep:known_by_projection chromosome:Sscrofa10.2:2:75503306:75510472:1 gene:ENSSSCG00000013494 transcript:ENSSSCT00000014740 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
LWGHIPEGQRLPPPQPGSLSRHLGSPRFLHAWHPPPISARMPSRRWAPGTQCITKCEHMR
PKPGELAFHKGDVVTILEACENKSWYRAKHHASGQEGLLAAGALREREALSADPKLSLMP
WFHGKISGQEAVQQLQPPEDGLFLVRESARHPGDYVLCVSFGRDVIHYRVLHREGHLTID
EVVCFCNLMDMVEHYSKDKGAICTKLVKPKRKQGTKSAEEELAKAGWLLNLQHLTLGAQI
GEGEFGAVLQGEYLGQKVAVKNIKCDVTAQAFLDETAVMTKMQHKNLVRLLGVILHQGLY
IVMEHVSKGNLVNFLRTRGRALVNTPQLLQFSLHVAEGMEYLESKKLVHRDLAARNILVS
EDLVAKVSDFGLAKAERKGLDSSRLPVKWTAPEALKHGKFSSKSDVWSFGVLLWEVFSYG
RAPYPKMSLKEVSEAVEKGYRMEPPEGCPGPIHALMGSCWEAEPARRPPFRKLAEKLARE
LRSAGPSAPSGGQDADGPTLTRSQEP
Download sequence
Identical sequences ENSSSCP00000014342 ENSSSCP00000014342

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]