SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSSSCP00000015122 from Sus scrofa 69_10.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSSSCP00000015122
Domain Number 1 Region: 71-211
Classification Level Classification E-value
Superfamily Toll/Interleukin receptor TIR domain 0.00000000000000314
Family Toll/Interleukin receptor TIR domain 0.0038
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSSSCP00000015122   Gene: ENSSSCG00000014216   Transcript: ENSSSCT00000015534
Sequence length 237
Comment pep:novel chromosome:Sscrofa10.2:2:124610898:124613028:1 gene:ENSSSCG00000014216 transcript:ENSSSCT00000015534 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGIGKSKTDPCLLSLSWSKSHGVDTSQKPHETDCTISEEIPLHGGEDVACSSSAEMPTGE
QEGADGVEEMPEEEAEEEVFLKFVILHAEDDTDEALRVQNLLQNDFGIKPGIIFAEMPCG
RQHLQNLDDAVNGSAWTILLLTENFLRDTWCKFQFYTSLMNSVNRQHKYNSVIPMRPLNN
PLPREKTPFALRTINALEEESRGFPTQVERIFQESVYQIQQAIWKETRNLVQRQLIA
Download sequence
Identical sequences A0A287BMU9
ENSSSCP00000015122 9823.ENSSSCP00000015122 NP_001191280.1.46622 XP_020934855.1.46622 XP_020934858.1.46622 XP_020934868.1.46622 ENSSSCP00000015122

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]