SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSSSCP00000015169 from Sus scrofa 69_10.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSSSCP00000015169
Domain Number 1 Region: 31-62
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.00000000432
Family TSP-1 type 1 repeat 0.006
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSSSCP00000015169   Gene: ENSSSCG00000014260   Transcript: ENSSSCT00000015581
Sequence length 65
Comment pep:known chromosome:Sscrofa10.2:2:137682928:137688133:-1 gene:ENSSSCG00000014260 transcript:ENSSSCT00000015581 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MNKNISIVDNKKCKYLTKPEPQIRKCNEQPCQTRWMMTEWTPCSRTCGKGMQSRQVACTQ
QLSNG
Download sequence
Identical sequences ENSSSCP00000015169 9823.ENSSSCP00000015169 ENSSSCP00000015169

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]