SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSSSCP00000015996 from Sus scrofa 69_10.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSSSCP00000015996
Domain Number 1 Region: 143-479
Classification Level Classification E-value
Superfamily Subtilisin-like 1.18e-88
Family Subtilases 0.0000000244
Further Details:      
 
Domain Number 2 Region: 473-619
Classification Level Classification E-value
Superfamily Galactose-binding domain-like 8.08e-36
Family Proprotein convertase P-domain 0.00081
Further Details:      
 
Domain Number 3 Region: 53-133
Classification Level Classification E-value
Superfamily Protease propeptides/inhibitors 0.00000000323
Family Prohormone convertase 1 pro-domain 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSSSCP00000015996   Gene: ENSSSCG00000015072   Transcript: ENSSSCT00000016438
Sequence length 786
Comment pep:known_by_projection chromosome:Sscrofa10.2:9:49636870:49663410:-1 gene:ENSSSCG00000015072 transcript:ENSSSCT00000016438 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MPKGRQKVPHSDAPLGLPARLWLELAGLFLLLPWVMGLVGAGGPGAQGPGGLSWAVHLDH
PEGEGEADLLEQQADALAQAAGLVNAGRIGELQGHYLLVQPAGHPQPQQAEAVRQQVEAV
LARHEAVRWHSEQRLLKRAKRSIHFNDPKYPQQWHLNNRRSPGRDINVTGVWERNVTGRG
VTVVVVDDGVEHTIQDIAPNYSPEGSYDLNSNDPDPMPHPDVENGNHHGTRCAGEIAAVP
NNSFCAVGVAYGSRIAGIRVLDGPLTDSMEAVAFNKHYQINDIYSCSWGPDDDGKTVDGP
HQLGKAALQHGVIAGRQGFGSIFVVASGNGGQHNDNCNYDGYANSIYTVTIGAVDEEGRM
PFYAEECASMLAVTFSGGDKMLRSIVTTDWDLQKGTGCTEGHTGTSAAAPLAAGMIALML
QVRPCLTWRDVQHIIVFTATQYEDRHADWITNEAGFSHSHQHGFGLLNAWRLVNAAKIWT
SVPYLASYVSPVLKEDKAIPLSARPLEVLWNVSRTDLEMSGLKTLEHVAVTVSITHPRRG
SLEVKLFCPSGMMSLIGAPRSMDSDPNGFNDWTFSTVRCWGERARGTYRLVIRDVGDEKS
QAGILRQWQLTLYGSVWSPVDIRDRQRLLESAMSGKYLHDGFTLPCPPGLKIPEEDGYTI
TPNTLKTLVLIGCFTVFWTIYYMLEVYLSQRNVASHPVCRSGPCHWPQQSRKAKEEGTEL
EAVPLCSSQDPGGVGTESEGPSAPSRLRAPDLLDQGDWSLSQNRGALDCPQRLPPDLLQG
KGEQIC
Download sequence
Identical sequences A0A287B301
ENSSSCP00000015996 ENSSSCP00000015996 XP_020918539.1.46622 9823.ENSSSCP00000015996

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]