SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSSSCP00000016240 from Sus scrofa 69_10.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSSSCP00000016240
Domain Number 1 Region: 233-409
Classification Level Classification E-value
Superfamily Ankyrin repeat 2.8e-25
Family Ankyrin repeat 0.0011
Further Details:      
 
Domain Number 2 Region: 520-629
Classification Level Classification E-value
Superfamily Second domain of FERM 6.8e-16
Family Second domain of FERM 0.0032
Further Details:      
 
Weak hits

Sequence:  ENSSSCP00000016240
Domain Number - Region: 421-511
Classification Level Classification E-value
Superfamily Ubiquitin-like 0.063
Family Ras-binding domain, RBD 0.028
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSSSCP00000016240   Gene: ENSSSCG00000015313   Transcript: ENSSSCT00000016686
Sequence length 735
Comment pep:known_by_projection chromosome:Sscrofa10.2:9:78873034:78909021:-1 gene:ENSSSCG00000015313 transcript:ENSSSCT00000016686 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGNPENIEDAYVAVIRPKNAASLNSREYRAKSYEILLHEVPIEGQKKKKKVLLETKLQGN
SEITQGILDYVVETTKPISPANQGIRGKRVILMKKFPLDGEKMGREAALFIVPSVVKDNT
KYTYTPGCPVFYCLQDIMRVCSESSTHFATLTARMLIALDKWLDERHAQSHFIPALFRPS
PLERIKTNVINPAYATESGQTENSLHMGYSALEIKSKMLALEKADACIYNPLFGSDLQYT
NRVDKVVINPYFGLGAPDYSKIQIPKQEKWQRSMSSVTEDKERQWVDDFPLHRSACEGDT
ELLSRLLNERFSVNQLDSDHWAPIHYACWYGKVEATRILLEKGKCNPNLLNGQLSSPLHF
AAGGGHAEIVQILLNHPEVDRHITDQQGRSPLNICEENKQNNWEDAAKLLKEAINKPYEK
VRIYRMDGSYRSVELKHGNNTTVQQIMEGMRLSQETQQYFTIWICSENLSLQLKPYHKPL
QHVRDWPEILAELTNLDPQRETPQLFLRRDVRLPLEIEKKIEDPLAILILFDEARYNLLK
GFYTAPDAKLITLASLLLQIVYGNYESKKHKQGFLNEENLKSIVPITKLKSKAPHWTNRI
LHEYKNLSTSEGISKEMHHLQRMFLQNCWEIPTYGAAFFTGQIFTKASPSNHKVIPVYVG
VNIKGLHLLNMETKALLISLKYGCFMWQLGDADTCFQIHSMENKMSFIVHTKQASLVVKL
LMKLNGQLMPTERNS
Download sequence
Identical sequences ENSSSCP00000016240 9823.ENSSSCP00000016240 ENSSSCP00000016240

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]