SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSSSCP00000016521 from Sus scrofa 69_10.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSSSCP00000016521
Domain Number 1 Region: 775-1069
Classification Level Classification E-value
Superfamily (Phosphotyrosine protein) phosphatases II 7.75e-91
Family Higher-molecular-weight phosphotyrosine protein phosphatases 0.0000102
Further Details:      
 
Domain Number 2 Region: 101-244
Classification Level Classification E-value
Superfamily PH domain-like 4e-30
Family Third domain of FERM 0.0071
Further Details:      
 
Domain Number 3 Region: 3-100
Classification Level Classification E-value
Superfamily Second domain of FERM 7.72e-26
Family Second domain of FERM 0.00053
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSSSCP00000016521   Gene: ENSSSCG00000015582   Transcript: ENSSSCT00000016975
Sequence length 1073
Comment pep:known_by_projection chromosome:Sscrofa10.2:9:142083587:142135830:1 gene:ENSSSCG00000015582 transcript:ENSSSCT00000016975 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MNRYQYYLQVKKDVLEGRLRCTLEQVIRLAGLAVQADFGDYNQFDSQDFLREYVLFPMDL
ALEEAVLEELTQKVAQEHKAHSGILPAEAELMYINEVERLDGFGQEVFPVKDSHGNSVHL
GIFFMGIFVRNRIGRQAVIYRWNDMGNVTHSKSTILVELISKDETALFHTDDIENAKYIS
RLFATRHKFYKQNKICTEQSNSPPPIRRQPTWSRSSLPRQQPYILPPVHVQCGEHYSETH
TSQDSIFHGNEEALYCNSHNSLDLNYLNGTVTNGSVCSVHSVNSLSCSQSFIQASPVSSS
LSIPGSDIMRADYIPSHRHSAIIVPSYRPTPDYETVMRQMKRGMVHTDSQSQSLRNLNII
NTHAYNQPEDLVYSQPEMRERHPYTVPYGPPGGYGNKLVSPSDQISPKSTTVPSKPGASA
ISHTVSTPELANMQLQGPQNYSTAHMLKNYLFRPPPPYPRPRPATSTPDLASHRHKYVSG
SSPDLVTRKVQLSVKTFQEDSSPVVHQSLQEVSEPLTASKHHGTVHKRHSLEVMSSMVRG
MEAMTLKSLNIPMARRNTLREPGPPAEVPASHEVPQLPPYHHKKTFSDATMLIHSSESEE
EEEEAPESVPQIPGLREKMEYSAQLQAALARIPNKPPPEYPGPRKSVSNGALRQDQGCLP
PAIARARVLRHGPATAISVSRADQLAVNGASLGPSLSEPDLTSVKERAKKEPVKERPVSE
MFSLEDSIIDAIVACPGIKKLTGLEAQKRPLMLAALNGLSVARGSGREESRVDAARVPMD
ERFRTLKKKLDEGMVFTEYEQIPKKKANGVFSTAALPENAERSRIREVVPYEENRVELIP
TKENSTGYINASHIKVVVGGAEWHYIATQGPLPHTCHDFWQMVWEQGANVIAMVTAEEEG
GRTKSHRYWPKLGSKHSSATYGKFKVTTKFRTDSGCYATTGLKVKHLLSGQERTVWHLQY
TDWPDHGCPEDVQGFLSYLEEIQSVRRHTNSMLEGTKNRHPPIVVHCSAGVGRTGVVILS
ELMIYCLEHNEKVDVPMMLRLLREQRMFMIQTIAQYKFVYQVLIQFLQNSRLI
Download sequence
Identical sequences ENSSSCP00000016521 ENSSSCP00000016521

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]