SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSSSCP00000016811 from Sus scrofa 69_10.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSSSCP00000016811
Domain Number 1 Region: 43-106
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 3.38e-17
Family LIM domain 0.0014
Further Details:      
 
Domain Number 2 Region: 224-287
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 3.78e-16
Family LIM domain 0.0011
Further Details:      
 
Domain Number 3 Region: 166-227
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 4.72e-16
Family LIM domain 0.002
Further Details:      
 
Domain Number 4 Region: 130-164
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 0.000000000000428
Family LIM domain 0.00077
Further Details:      
 
Domain Number 5 Region: 6-40
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 0.0000000000141
Family LIM domain 0.0027
Further Details:      
 
Domain Number 6 Region: 101-132
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 0.0000000000767
Family LIM domain 0.0013
Further Details:      
 
Weak hits

Sequence:  ENSSSCP00000016811
Domain Number - Region: 283-312
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 0.00606
Family LIM domain 0.024
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSSSCP00000016811   Gene: ENSSSCG00000015862   Transcript: ENSSSCT00000017273
Sequence length 341
Comment pep:known_by_projection chromosome:Sscrofa10.2:15:66435456:66453016:-1 gene:ENSSSCG00000015862 transcript:ENSSSCT00000017273 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
FLPSNMSNALANAVCQRCQARFAPSERIVNSNGELYHEHCFVCAQCFRPFPEGLFYEFEG
RKYCEHDFQMLFAPCCGSCGEFIIGRVIKAMNNNWHPGCFRCELCDVELADLGFVKNAGR
HLCRPCHNREKAKGLGKYICQRCHLVIDEQPLMFRNDAYHPDHFNCTHCGKELTAEAREL
KGELYCLPCHDKMGVPICGACRRPIEGRVVNALGKQWHVEHFVCAKCEKPFLGHRHYEKK
GLAYCETHYNQLFGDVCYNCSHVIEGDVVSALNKAWCVNCFSCSTCNSRLTLKNKFVEFD
MKPVCKRCYEKFPLELKKRLKKLSELVARRAQPKSSGLHSA
Download sequence
Identical sequences ENSSSCP00000016811 ENSSSCP00000016811

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]