SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSSSCP00000017111 from Sus scrofa 69_10.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSSSCP00000017111
Domain Number 1 Region: 1-181
Classification Level Classification E-value
Superfamily Ribulose-phoshate binding barrel 1.47e-56
Family D-ribulose-5-phosphate 3-epimerase 0.00000648
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSSSCP00000017111   Gene: ENSSSCG00000016152   Transcript: ENSSSCT00000017585
Sequence length 190
Comment pep:known chromosome:Sscrofa10.2:15:124443426:124459649:1 gene:ENSSSCG00000016152 transcript:ENSSSCT00000017585 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MDGHFVPNITFGHPVVESLRKQLGQDPFFDMHMMVSRPEQWVKPMAVAGANQYTFHLEAT
ENPGALIKDIRENGMKVGLAIKPGTTVEYLAPWANQIDMALVMTVEPGFGGQKFMEDMMP
KVHWLRTQFPSLDIEVDGGVGPDTIHKCAEAGANMIVSGSAIMRSEDPRSVINLLRNVCS
EAAQKRSLDR
Download sequence
Identical sequences ENSSSCP00000017111 ENSSSCP00000017111 9823.ENSSSCP00000017113

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]