SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSSSCP00000017796 from Sus scrofa 69_10.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSSSCP00000017796
Domain Number 1 Region: 88-181
Classification Level Classification E-value
Superfamily Virus ectodomain 1.22e-19
Family Virus ectodomain 0.0032
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSSSCP00000017796   Gene: ENSSSCG00000016801   Transcript: ENSSSCT00000018291
Sequence length 285
Comment pep:known chromosome:Sscrofa10.2:9:114036377:114037547:1 gene:ENSSSCG00000016801 transcript:ENSSSCT00000018291 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
LRHPHNKSQFQVPQADVWWSCGSPLIGIHPENQSDTCTLVQLAIPFDLAFRPQSQKRDIT
PITPFDPQVCIDSIGVPNKFKARNHVAVRFESAPFWWSTVNKNVNRITCIFCNQQRLINY
IRDAIKEIAEQLGPTSQMAWEKRLALDMMLAEKGGVCVVMGILCCTFIPNNSTPDGTITK
ALGGLTTLADELSENSGINDPFTELLENWFKKWKGLIASIFTPQTAVVSVRVLVACCYNS
LCQGTHLKIKRSNWDPPPHQANILLMDTIEHESQTMLKEFEEKSI
Download sequence
Identical sequences ENSSSCP00000017796 ENSSSCP00000017796

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]